CacheBy
Atlas Antibodies Anti-ZNF230 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZNF230 Antibody

상품 한눈에 보기

Human ZNF230 단백질을 인식하는 토끼 폴리클로날 항체로, WB 및 ICC 분석에 적합합니다. PrEST 항원으로 친화 정제되었으며, 40% 글리세롤 기반 PBS 버퍼에 보존됩니다. 인간 특이적으로 검증되어 신뢰성 높은 단백질 발현 분석에 활용 가능합니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006172-100 Anti-ZNF230 Antibody, zinc finger protein 230 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006172-25 Anti-ZNF230 Antibody, zinc finger protein 230 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZNF230 Antibody

Anti-ZNF230 Antibody

Target: zinc finger protein 230 (ZNF230)
Supplier: Atlas Antibodies


  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human ZNF230.


Alternative Gene Names

  • FDZF2

Open Datasheet (PDF)


Target Information

  • Target Protein: zinc finger protein 230
  • Target Gene: ZNF230
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
GKTIAEAGPHEDCPCQQIWEQTASDLTQSQDSIINNSHFFEQGDVPSQVEAGLSIIHTGQKPSQNGKCKQSFSDVAIFDPPQQFHSGEKS

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Identity
Rat ENSRNOG00000053635 29%
Mouse ENSMUSG00000006720 29%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (MSDS)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.