CacheBy
Thermo Fisher Scientific FBXO32 Polyclonal Antibody
원본

Thermo Fisher Scientific FBXO32 Polyclonal Antibody

상품 한눈에 보기

Human FBXO32 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC/IF에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, PBS(40% glycerol) 버퍼에 보존됩니다. 근육 위축 관련 연구에 유용하며, 연구용으로만 사용 가능합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 04. 오후 06:59
Thermo Fisher Scientific PA566751 FBXO32 Polyclonal Antibody 100 ul pk판매 단위 pk ·
재고 확인 필요
791,800원VAT 포함 870,980원

Thermo Fisher Scientific · Thermo Fisher Scientific FBXO32 Polyclonal Antibody

Applications

Immunocytochemistry (ICC/IF)

  • Tested Dilution: 0.25–2 µg/mL

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen Recombinant Human FBXO32. Recombinant protein control fragment (Product #RP-107408)
Conjugate Unconjugated
Form Liquid
Concentration 0.7 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS, pH 7.2, with 40% glycerol
Contains 0.02% sodium azide
Storage Conditions Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping Conditions Wet ice
RRID AB_2664323

Product Specific Information

Immunogen sequence:
PGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSK

  • Highest antigen sequence identity to orthologs: mouse 92%, rat 85%

Target Information

This gene encodes a member of the F-box protein family characterized by an approximately 40 amino acid F-box motif. F-box proteins are components of the SCF ubiquitin ligase complex, which mediates phosphorylation-dependent ubiquitination.
They are classified into three groups:

  • Fbws: containing WD-40 domains
  • Fbls: containing leucine-rich repeats
  • Fbxs: containing various protein-protein interaction modules or no recognizable motifs

The FBXO32 protein belongs to the Fbxs class and contains an F-box domain. It is highly expressed during muscle atrophy, and knockout mice show resistance to atrophy. Therefore, FBXO32 is a potential drug target for treating muscle atrophy.
Alternative splicing results in two transcript variants encoding isoforms of different sizes.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.