Thermo Fisher Scientific FBXO32 Polyclonal Antibody
Human FBXO32 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC/IF에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, PBS(40% glycerol) 버퍼에 보존됩니다. 근육 위축 관련 연구에 유용하며, 연구용으로만 사용 가능합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Immunocytochemistry (ICC/IF)
- Tested Dilution: 0.25–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant Human FBXO32. Recombinant protein control fragment (Product #RP-107408) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.7 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2664323 |
Product Specific Information
Immunogen sequence:
PGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSK
- Highest antigen sequence identity to orthologs: mouse 92%, rat 85%
Target Information
This gene encodes a member of the F-box protein family characterized by an approximately 40 amino acid F-box motif. F-box proteins are components of the SCF ubiquitin ligase complex, which mediates phosphorylation-dependent ubiquitination.
They are classified into three groups:
- Fbws: containing WD-40 domains
- Fbls: containing leucine-rich repeats
- Fbxs: containing various protein-protein interaction modules or no recognizable motifs
The FBXO32 protein belongs to the Fbxs class and contains an F-box domain. It is highly expressed during muscle atrophy, and knockout mice show resistance to atrophy. Therefore, FBXO32 is a potential drug target for treating muscle atrophy.
Alternative splicing results in two transcript variants encoding isoforms of different sizes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
Thermo Fisher Scientific
Thermo Fisher Scientific TMEM50A Polyclonal Antibody
791,800원
Thermo Fisher Scientific
Thermo Fisher Scientific TCEAL7 Polyclonal Antibody
791,800원
Thermo Fisher Scientific
Thermo Fisher Scientific FBXO32 Polyclonal Antibody
791,800원
Thermo Fisher Scientific
Thermo Fisher Scientific CPSF1 Polyclonal Antibody
791,800원
Thermo Fisher Scientific
Thermo Fisher Scientific ZNF444 Polyclonal Antibody
791,800원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|