Thermo Fisher Scientific FBXO32 Polyclonal Antibody
Human FBXO32 단백질을 인식하는 Rabbit Polyclonal 항체로, ICC/IF에 적합합니다. 항원 친화 크로마토그래피로 정제되었으며, PBS(40% glycerol) 버퍼에 보존됩니다. 근육 위축 관련 연구에 유용하며, 연구용으로만 사용 가능합니다.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific FBXO32 Polyclonal Antibody
Applications
Immunocytochemistry (ICC/IF)
- Tested Dilution: 0.25–2 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | Recombinant Human FBXO32. Recombinant protein control fragment (Product #RP-107408) |
| Conjugate | Unconjugated |
| Form | Liquid |
| Concentration | 0.7 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.2, with 40% glycerol |
| Contains | 0.02% sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2664323 |
Product Specific Information
Immunogen sequence:
PGQNWVKTADGWKRFLDEKSGSFVSDLSSYCNKEVYNKENLFNSLNYDVAAKKRKKDMLNSK
- Highest antigen sequence identity to orthologs: mouse 92%, rat 85%
Target Information
This gene encodes a member of the F-box protein family characterized by an approximately 40 amino acid F-box motif. F-box proteins are components of the SCF ubiquitin ligase complex, which mediates phosphorylation-dependent ubiquitination.
They are classified into three groups:
- Fbws: containing WD-40 domains
- Fbls: containing leucine-rich repeats
- Fbxs: containing various protein-protein interaction modules or no recognizable motifs
The FBXO32 protein belongs to the Fbxs class and contains an F-box domain. It is highly expressed during muscle atrophy, and knockout mice show resistance to atrophy. Therefore, FBXO32 is a potential drug target for treating muscle atrophy.
Alternative splicing results in two transcript variants encoding isoforms of different sizes.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.