
Thermo Fisher Scientific SKA2 Polyclonal Antibody
Thermo Fisher Scientific의 SKA2 Polyclonal Antibody는 인간 SKA2 단백질을 인식하는 토끼 유래 다클론 항체입니다. Western blot과 유세포분석에 적합하며, 세포 분열 시 방추체 및 키네토코어 복합체 연구에 활용됩니다. 동결건조 형태로 제공되며, 장기 보관이 용이합니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.25–0.5 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human SKA2 (EAEVDKLELMFQKAESDLDYIQYRLEYEIK) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C (short term). For long-term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2884842 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Upon entry into mitosis, the cell’s microtubule (MT) network forms the mitotic spindle, allowing the segregation of paired chromosomes. Proteinaceous structures on centromeric chromatin termed kinetochores (KT) are essential for proper attachment of chromosomes to the spindle MTs.
A recently discovered spindle and kinetochore complex, comprised of proteins SKA1, SKA2, and SKA3, is required for stable KT–MT interactions and timely anaphase onset. Depletion of either SKA1 or SKA2 by siRNA results in loss of both proteins from the KT, without impacting overall KT structure.
Cells depleted of the SKA complex undergo a prolonged checkpoint-dependent delay in a metaphase-like state, indicating the importance of the SKA complex in maintaining the metaphase plate and spindle checkpoint silencing.
SKA2 has also been shown to interact with glucocorticoid receptors and to be involved in glucocorticoid signaling and cell proliferation.
For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific FSCN2 Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific LOR Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific SKA2 Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific HERC5 Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific POMT2 Polyclonal Antibody
680,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|