CacheBy
Thermo Fisher Scientific SKA2 Polyclonal Antibody
원본

Thermo Fisher Scientific SKA2 Polyclonal Antibody

상품 한눈에 보기

Thermo Fisher Scientific의 SKA2 Polyclonal Antibody는 인간 SKA2 단백질을 인식하는 토끼 유래 다클론 항체입니다. Western blot과 유세포분석에 적합하며, 세포 분열 시 방추체 및 키네토코어 복합체 연구에 활용됩니다. 동결건조 형태로 제공되며, 장기 보관이 용이합니다.

판매단위
pk
카탈로그 보기

카탈로그

1개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 01. 오후 06:39
Thermo Fisher Scientific PA5114386 SKA2 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
680,400원VAT 포함 748,440원

Thermo Fisher Scientific · Thermo Fisher Scientific SKA2 Polyclonal Antibody

Applications and Tested Dilution

Application Tested Dilution
Western Blot (WB) 0.25–0.5 µg/mL
Flow Cytometry (Flow) 1–3 µg/1×10⁶ cells

Product Specifications

항목 내용
Species Reactivity Human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen A synthetic peptide corresponding to a sequence of human SKA2 (EAEVDKLELMFQKAESDLDYIQYRLEYEIK)
Conjugate Unconjugated
Form Lyophilized
Concentration 500 µg/mL
Purification Affinity chromatography
Storage Buffer PBS with 4 mg trehalose
Contains 0.05 mg sodium azide
Storage Conditions Store at 4°C (short term). For long-term storage, store at -20°C, avoiding freeze/thaw cycles.
Shipping Conditions Wet ice
RRID AB_2884842

Product Specific Information

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.

Target Information

Upon entry into mitosis, the cell’s microtubule (MT) network forms the mitotic spindle, allowing the segregation of paired chromosomes. Proteinaceous structures on centromeric chromatin termed kinetochores (KT) are essential for proper attachment of chromosomes to the spindle MTs.
A recently discovered spindle and kinetochore complex, comprised of proteins SKA1, SKA2, and SKA3, is required for stable KT–MT interactions and timely anaphase onset. Depletion of either SKA1 or SKA2 by siRNA results in loss of both proteins from the KT, without impacting overall KT structure.
Cells depleted of the SKA complex undergo a prolonged checkpoint-dependent delay in a metaphase-like state, indicating the importance of the SKA complex in maintaining the metaphase plate and spindle checkpoint silencing.
SKA2 has also been shown to interact with glucocorticoid receptors and to be involved in glucocorticoid signaling and cell proliferation.


For Research Use Only.
Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.