
Thermo Fisher Scientific DVL3 Polyclonal Antibody
DVL3 단백질을 인식하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot에 적합하며, 합성 펩타이드 면역원으로 제작되었습니다. 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397–434 aa: DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMWL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2884831 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene is a member of a multi-gene family which shares strong similarity with the Drosophila disheveled gene (dsh). The Drosophila disheveled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific ACACB Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific CLIF Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific DVL3 Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific GPD1L Polyclonal Antibody
680,400원

Thermo Fisher Scientific
Thermo Fisher Scientific ALDH18A1 Polyclonal Antibody
680,400원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|