
원본
Thermo Fisher Scientific DVL3 Polyclonal Antibody
상품 한눈에 보기
DVL3 단백질을 인식하는 Rabbit Polyclonal 항체로, Human, Mouse, Rat 시료에 반응합니다. Western blot에 적합하며, 합성 펩타이드 면역원으로 제작되었습니다. 친화 크로마토그래피로 정제되었으며, 동결건조 형태로 제공됩니다.
- 카탈로그번호
- PA5114375
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2025. 08. 02. 오전 07:19
카탈로그 번호 · 상품 설명출고판매가담기
Thermo Fisher Scientific PA5114375 DVL3 Polyclonal Antibody 100 ug pk판매 단위 pk ·
재고 확인 필요
680,400원VAT 포함 748,440원
Thermo Fisher Scientific · Thermo Fisher Scientific DVL3 Polyclonal Antibody
Applications
Western Blot (WB)
- Tested Dilution: 0.1–0.5 µg/mL
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence in the middle region of human Dishevelled 3 (397–434 aa: DTERLDDFHLSIHSDMAAIVKAMASPESGLEVRDRMWL) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage buffer | PBS with 5 mg BSA |
| Contains | 0.05 mg sodium azide |
| Storage conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping conditions | Ambient (domestic); Wet ice (international) |
| RRID | AB_2884831 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
This gene is a member of a multi-gene family which shares strong similarity with the Drosophila disheveled gene (dsh). The Drosophila disheveled gene encodes a cytoplasmic phosphoprotein that regulates cell proliferation.
For Research Use Only.
Not for use in diagnostic procedures.
Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.
