Thermo Fisher Scientific ACACB Polyclonal Antibody
ACACB 단백질을 인식하는 Thermo Fisher Scientific의 Rabbit Polyclonal Antibody로, WB, IHC, Flow Cytometry에 사용 가능. 고순도 친화 크로마토그래피 정제, 500 µg/mL 농도. 지방산 및 포도당 대사 연구용에 적합.
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific ACACB Polyclonal Antibody
Applications and Tested Dilution
| Application | Tested Dilution |
|---|---|
| Western Blot (WB) | 0.25–0.5 µg/mL |
| Immunohistochemistry (Paraffin) (IHC (P)) | 0.5–1 µg/mL |
| Flow Cytometry (Flow) | 1–3 µg/1×10⁶ cells |
Product Specifications
| Specification | Description |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | A synthetic peptide corresponding to a sequence of human Acetyl Coenzyme A Carboxylase/ACACB (EENPEVAVDCVIYLSQHISPAERAQVVHLLSTMD). |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 500 µg/mL |
| Purification | Affinity chromatography |
| Storage Buffer | PBS with 4 mg trehalose |
| Contains | 0.05 mg sodium azide |
| Storage Conditions | Store at 4°C short term. For long term storage, store at -20°C, avoiding freeze/thaw cycles. |
| Shipping Conditions | Wet ice |
| RRID | AB_2884832 |
Product Specific Information
Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 µg/mL.
Target Information
Catalyzes the ATP-dependent carboxylation of acetyl-CoA to malonyl-CoA. Functions include biotin carboxyl carrier protein, biotin carboxylase, and carboxyltransferase activities. Involved in inhibition of fatty acid and glucose oxidation and enhancement of fat storage. May regulate mitochondrial fatty acid oxidation through malonyl-CoA-dependent inhibition of carnitine palmitoyltransferase 1.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.