Thermo Fisher Scientific Aquaporin 4 (AQP4) (249-323) Polyclonal Antibody
Rabbit polyclonal antibody recognizing Aquaporin 4 (AQP4, aa 249–323). Validated for Western blot in human, mouse, and rat samples. Lyophilized form, reconstitutable with DDW. Suitable for research use only.
- 카탈로그번호
- AQP-004-xxxxx (3개 옵션)
- 판매단위
- pk
카탈로그
3개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Aquaporin 4 (AQP4) (249-323) Polyclonal Antibody
Applications
- Western Blot (WB): Tested dilution 1:100
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249–323 of rat AQP4 (Intracellular, C-terminus) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.4, with 1% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
- Reconstitution: Add 25 µL, 50 µL, or 0.2 mL double-distilled water (DDW), depending on sample size.
- Storage after reconstitution: Store at 4°C, protected from light, for up to 1 week. For long-term storage, aliquot and keep at -20°C.
- Handling: Avoid multiple freeze/thaw cycles. Centrifuge all antibody preparations before use (10,000 × g, 5 min).
- Shipping: Ships lyophilized at room temperature.
Target Information
Aquaporin 4 (AQP4) is a water channel protein localized mainly in the sarcolemma of fast-twitch muscle fibers. It belongs to the aquaporin family (AQP0–AQP10), which facilitates water transport across cell membranes. While most AQPs are selective for water, AQP3, AQP7, AQP9, and some AQP10 isoforms can also transport urea and glycerol. AQPs are widely distributed across tissues and species, often with multiple isoforms present in the same cell.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.