
Thermo Fisher Scientific Aquaporin 4 (AQP4) (249-323) Polyclonal Antibody
Rabbit polyclonal antibody recognizing Aquaporin 4 (AQP4, aa 249–323). Validated for Western blot in human, mouse, and rat samples. Lyophilized form, reconstitutable with DDW. Suitable for research use only.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Western Blot (WB): Tested dilution 1:100
Product Specifications
| 항목 | 내용 |
|---|---|
| Species Reactivity | Human, Mouse, Rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen | GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249–323 of rat AQP4 (Intracellular, C-terminus) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 1 mg/mL |
| Purification | Antigen affinity chromatography |
| Storage Buffer | PBS, pH 7.4, with 1% BSA |
| Contains | 0.05% sodium azide |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Ambient (domestic); Wet ice (international) |
Product Specific Information
- Reconstitution: Add 25 µL, 50 µL, or 0.2 mL double-distilled water (DDW), depending on sample size.
- Storage after reconstitution: Store at 4°C, protected from light, for up to 1 week. For long-term storage, aliquot and keep at -20°C.
- Handling: Avoid multiple freeze/thaw cycles. Centrifuge all antibody preparations before use (10,000 × g, 5 min).
- Shipping: Ships lyophilized at room temperature.
Target Information
Aquaporin 4 (AQP4) is a water channel protein localized mainly in the sarcolemma of fast-twitch muscle fibers. It belongs to the aquaporin family (AQP0–AQP10), which facilitates water transport across cell membranes. While most AQPs are selective for water, AQP3, AQP7, AQP9, and some AQP10 isoforms can also transport urea and glycerol. AQPs are widely distributed across tissues and species, often with multiple isoforms present in the same cell.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 10 Polyclonal Antibody
449,700원

Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 4 (AQP4) Polyclonal Antibody, Atto 594
1,303,100원

Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 4 (AQP4) (249-323) Polyclonal Antibody
742,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 8 Polyclonal Antibody
923,800원

Thermo Fisher Scientific
Thermo Fisher Scientific Aquaporin 11 (extracellular) Polyclonal Antibody
742,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|