CacheBy
Thermo Fisher Scientific Aquaporin 4 (AQP4) (249-323) Polyclonal Antibody
원본

Thermo Fisher Scientific Aquaporin 4 (AQP4) (249-323) Polyclonal Antibody

상품 한눈에 보기

Rabbit polyclonal antibody recognizing Aquaporin 4 (AQP4, aa 249–323). Validated for Western blot in human, mouse, and rat samples. Lyophilized form, reconstitutable with DDW. Suitable for research use only.

판매단위
pk
카탈로그 보기

카탈로그

3개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
마지막 업데이트 2026. 05. 06. 오전 11:13
Thermo Fisher Scientific AQP-004-200UL Aquaporin 4 (AQP4) (249-323) Polyclonal Antibody 200 ul pk판매 단위 pk ·
재고 확인 필요
1,161,300원VAT 포함 1,277,430원
Thermo Fisher Scientific AQP-004-50UL Aquaporin 4 (AQP4) (249-323) Polyclonal Antibody 50 ul pk판매 단위 pk
재고 1개
957,000원VAT 포함 1,052,700원
Thermo Fisher Scientific AQP-004-25UL Aquaporin 4 (AQP4) (249-323) Polyclonal Antibody 25 ul pk판매 단위 pk
재고 1개
768,400원VAT 포함 845,240원

Thermo Fisher Scientific · Thermo Fisher Scientific Aquaporin 4 (AQP4) (249-323) Polyclonal Antibody

Applications

  • Western Blot (WB): Tested dilution 1:100

Product Specifications

항목 내용
Species Reactivity Human, Mouse, Rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen GST fusion protein with the sequence EYVFCPDVELKRRLKEAFSKAAQQTKGSYMEVEDNRSQVETEDLILKPGVVHVIDIDRGDEKKGKDSSGEVLSSV, corresponding to amino acid residues 249–323 of rat AQP4 (Intracellular, C-terminus)
Conjugate Unconjugated
Form Lyophilized
Concentration 1 mg/mL
Purification Antigen affinity chromatography
Storage Buffer PBS, pH 7.4, with 1% BSA
Contains 0.05% sodium azide
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Ambient (domestic); Wet ice (international)

Product Specific Information

  • Reconstitution: Add 25 µL, 50 µL, or 0.2 mL double-distilled water (DDW), depending on sample size.
  • Storage after reconstitution: Store at 4°C, protected from light, for up to 1 week. For long-term storage, aliquot and keep at -20°C.
  • Handling: Avoid multiple freeze/thaw cycles. Centrifuge all antibody preparations before use (10,000 × g, 5 min).
  • Shipping: Ships lyophilized at room temperature.

Target Information

Aquaporin 4 (AQP4) is a water channel protein localized mainly in the sarcolemma of fast-twitch muscle fibers. It belongs to the aquaporin family (AQP0–AQP10), which facilitates water transport across cell membranes. While most AQPs are selective for water, AQP3, AQP7, AQP9, and some AQP10 isoforms can also transport urea and glycerol. AQPs are widely distributed across tissues and species, often with multiple isoforms present in the same cell.


For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.

Thermo Fisher Scientific 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.