Atlas Antibodies Anti-ZNF207 Antibody
상품 옵션 정보 | |||||||||
---|---|---|---|---|---|---|---|---|---|
카탈로그 번호 | CAS 번호 | 설명 | 상태 | 재고 | 단위 | 판매가 | 할인가 | 가격(VAT포함) | 수량 / 장바구니 / 찜 |
HPA063908-100 | - | Atlas Antibodies HPA063908-100 Anti-ZNF207 Antibody, zinc finger protein 207 100ul | 재고문의 | 100ul | 728,000원 | - | 800,800원 | ||
HPA063908-25 | - | Atlas Antibodies HPA063908-25 Anti-ZNF207 Antibody, zinc finger protein 207 25ul | 재고문의 | 25ul | 528,000원 | - | 580,800원 |
다른 상품 둘러보기
Anti-ZNF207 Antibody
zinc finger protein 207
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Genetic validation in WB by siRNA knockdown.
Product Description
Polyclonal Antibody against Human ZNF207
Target Protein
zinc finger protein 207
Target Gene
ZNF207
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Copy sequence to clipboard
KPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGP
Verified Species Reactivity
Human, Mouse, Rat
Interspecies Information
Highest antigen sequence identity to the following orthologs:
Rat ENSRNOG00000000236 (99%)
Mouse ENSMUSG00000017421 (97%)
Clonality
Polyclonal
Isotype
IgG
Host
Rabbit
Buffer
40% glycerol and PBS (pH 7.2). 0.02% sodium azide is added as preservative. [Material Safety Data Sheet](https://atlasantibodies.s3-external-3.amazonaws.com/files/msds_sodium_azide.pdf Material Safety Data Sheet
)
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
배송/결제/교환/반품 안내
배송 정보
기본 배송비 |
| 교환/반품 배송비 |
|
---|---|---|---|
착불 배송비 |
| ||
교환/반품 배송비 |
|
결제 및 환불 안내
결제 방법 |
|
---|---|
취소 |
|
반품 |
|
환급 |
|
교환 및 반품 접수
교환 및 반품 접수 기한 |
|
---|---|
교환 및 반품 접수가 가능한 경우 |
|
교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
교환 절차 |
|
---|---|
반품 절차 |
|