Atlas Antibodies Anti-ZNF207 Antibody

상품 한눈에 보기

Human ZNF207 단백질을 인식하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 독립 항체 검증 및 siRNA 노크다운을 통한 유전적 검증으로 신뢰성이 높습니다. 토끼 유래 IgG 항체이며, PrEST 항원을 이용해 친화 정제되었습니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA017013-100 Anti-ZNF207 Antibody, zinc finger protein 207 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA017013-25 Anti-ZNF207 Antibody, zinc finger protein 207 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-ZNF207 Antibody

Anti-ZNF207 Antibody

Target: Zinc Finger Protein 207 (ZNF207)
Type: Polyclonal Antibody against Human ZNF207

Recommended Applications

IHC (Independent Validation): Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Genetic Validation): Genetic validation in WB by siRNA knockdown.
ICC: Suitable for immunocytochemistry applications.

Product Description

Polyclonal antibody raised in rabbit against the human ZNF207 protein.
Validated for multiple applications with enhanced validation standards.

Open Datasheet

Specifications

항목	내용
Target Protein	Zinc Finger Protein 207
Target Gene	ZNF207
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	KPATLTTTSATSKLIHPDEDISLEERRAQLPKYQRNLPRPGQAPIGNPPVGPIGGMMPPQPGIPQQQGMRPPMPPHGQYGGHHQGMPGYLPGAMPPYGQGP
Verified Species Reactivity	Human, Mouse, Rat
Interspecies Information	Rat ENSRNOG00000000236 (99%), Mouse ENSMUSG00000017421 (97%)
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
MSDS	Material Safety Data Sheet