
Atlas Antibodies Anti-ZMYND8 Antibody
상품 한눈에 보기
Human ZMYND8 단백질을 인식하는 토끼 폴리클로날 항체로 IHC, WB, ICC에 사용 가능. PrEST 항원을 이용해 친화 정제됨. Orthogonal validation으로 RNA-seq 데이터와 단백질 발현 일치 검증 완료. Human에 특이적이며 Rat, Mouse와 92% 서열 동일성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZMYND8 Antibody
Target: zinc finger, MYND-type containing 8
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, Orthogonal validation)
Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines. - Immunocytochemistry (ICC)
Product Description
Polyclonal Antibody against Human ZMYND8
Alternative Gene Names
- PRKCBP1
- RACK7
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger, MYND-type containing 8 |
| Target Gene | ZMYND8 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | TTKTDKTSTTGSILNLNLDRSKAEMDLKELSESVQQQSTPVPLISPKRQIRSRFQLNLDKTIESCKAQLGINEISEDVYTAVEHSDSEDSEKSDSSDSEYISDDEQKSKN |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Rat ENSRNOG00000019154 (92%)
- Mouse ENSMUSG00000039671 (92%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZNF101 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZMYND19 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZMYND8 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZNF112 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZMYM4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.