CacheBy
Atlas Antibodies Anti-ZMYM4 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZMYM4 Antibody

상품 한눈에 보기

인간 ZMYM4 단백질을 인식하는 폴리클로날 항체입니다. IHC 및 ICC 응용에 적합하며, 토끼에서 생산된 IgG 형식입니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 PBS 버퍼에 보존되어 있습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051301-100 Anti-ZMYM4 Antibody, zinc finger, MYM-type 4 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051301-25 Anti-ZMYM4 Antibody, zinc finger, MYM-type 4 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZMYM4 Antibody

Anti-ZMYM4 Antibody

Target: zinc finger, MYM-type 4
Type: Polyclonal Antibody against Human ZMYM4


  • IHC (Immunohistochemistry)
  • ICC (Immunocytochemistry)

Product Description

Polyclonal antibody raised in rabbit against human ZMYM4 protein. Affinity purified using the PrEST antigen as affinity ligand.


Alternative Gene Names

KIAA0425, MYM, ZNF198L3, ZNF262

Open Datasheet (PDF)


Antigen Information

Antigen Type: Recombinant Protein Epitope Signature Tag (PrEST)
Sequence:

WEEELNHYALKSNAVQEADSELKQFSKGETEQDLEADFPSDSFDPLNKGQGIQARSRTRRRHRDGFPQPRRRGRKKSIVAVEPRSLI

Species Reactivity

  • Verified: Human
  • Interspecies Homology:
    • Rat (ENSRNOG00000012397) – 95%
    • Mouse (ENSMUSG00000042446) – 94%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide
Preservative Sodium azide (see Material Safety Data Sheet)
Purification Method Affinity purified using PrEST antigen
Storage Store at recommended conditions; mix gently before use
Application Note Optimal concentrations and conditions should be determined by the user

Notes

Gently mix before use. Optimal working conditions should be empirically determined.


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.