
Atlas Antibodies Anti-ZMAT5 Antibody
상품 한눈에 보기
Human ZMAT5 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 제작되었으며, 재조합 발현 검증을 완료했습니다. 높은 종간 보존성과 신뢰성 있는 결과를 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZMAT5 Antibody
zinc finger, matrin-type 5
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot, Recombinant Expression Validation)
- Recombinant expression validation in WB using target protein overexpression.
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human ZMAT5
Alternative Gene Names
- SNRNP20
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger, matrin-type 5 |
| Target Gene | ZMAT5 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | RKKHLNGLQHLKAKKVWYDMFRDAAAILLDEQNKRPCRKFLLTGQCDFGSNCRFSHMSERDLQELSIQVEEERRAREWLLDAPELPEGHLEDWLEKRAKRLSSAPS |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (94%), Rat (93%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2). Contains 0.02% sodium azide as preservative. Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZMPSTE24 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZMIZ2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZMAT5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZMIZ1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZMIZ1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.