CacheBy
Atlas Antibodies Anti-ZMPSTE24 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZMPSTE24 Antibody

상품 한눈에 보기

인간 ZMPSTE24 단백질을 인식하는 폴리클로날 항체로, IHC 및 WB에 적합합니다. 토끼 유래 IgG 항체이며 PrEST 항원을 이용해 친화 정제되었습니다. 높은 종간 서열 유사도를 보여 인간 외에도 쥐와 생쥐에서 반응성이 기대됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006988-100 Anti-ZMPSTE24 Antibody, zinc metallopeptidase STE24 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006988-25 Anti-ZMPSTE24 Antibody, zinc metallopeptidase STE24 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZMPSTE24 Antibody

Anti-ZMPSTE24 Antibody

Target Protein: zinc metallopeptidase STE24
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human ZMPSTE24.


Alternative Gene Names

FACE-1, HGPS, PRO1, STE24, Ste24p

Open Datasheet


Antigen Information

Antigen Sequence (Recombinant Protein Epitope Signature Tag, PrEST):
KTTTHVPPELGQIMDSETFEKSRLYQLDKSTFS


Verified Species Reactivity

Human


Interspecies Information

Highest antigen sequence identity to the following orthologs:

Species Gene ID Sequence Identity
Rat ENSRNOG00000012054 94%
Mouse ENSMUSG00000043207 88%

Antibody Characteristics

Property Description
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet (Sodium Azide)


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application Icon
WB Application Icon

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.