Atlas Antibodies Anti-ZC3HC1 Antibody

상품 한눈에 보기

인간 ZC3HC1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 독립 항체 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 반응하며 NIPA 유전자를 타깃으로 함.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA024023-100 Anti-ZC3HC1 Antibody, zinc finger, C3HC-type containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA024023-25 Anti-ZC3HC1 Antibody, zinc finger, C3HC-type containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: zinc finger, C3HC-type containing 1 (ZC3HC1)
Type: Polyclonal Antibody against Human ZC3HC1
Alternative Gene Name: NIPA

IHC (Immunohistochemistry)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody produced in rabbit against human ZC3HC1.
Affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

CEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSATSQSVNGSPQAEQPSLESTSKEAFFSRVETFSSLKWAGKPFELSPLVCAKYGWV

Species	Gene ID	Sequence Identity
Rat	ENSRNOG00000010154	83%
Mouse	ENSMUSG00000039130	79%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.