CacheBy
Atlas Antibodies Anti-ZC3HC1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZC3HC1 Antibody

상품 한눈에 보기

인간 ZC3HC1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 독립 항체 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 반응하며 NIPA 유전자를 타깃으로 함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA024023-100 Anti-ZC3HC1 Antibody, zinc finger, C3HC-type containing 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA024023-25 Anti-ZC3HC1 Antibody, zinc finger, C3HC-type containing 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZC3HC1 Antibody

Anti-ZC3HC1 Antibody

Target: zinc finger, C3HC-type containing 1 (ZC3HC1)
Type: Polyclonal Antibody against Human ZC3HC1
Alternative Gene Name: NIPA


  • IHC (Immunohistochemistry)
    Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody produced in rabbit against human ZC3HC1.
Affinity purified using the PrEST antigen as affinity ligand.


Antigen Information

  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
    CEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSATSQSVNGSPQAEQPSLESTSKEAFFSRVETFSSLKWAGKPFELSPLVCAKYGWV

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000010154 83%
Mouse ENSMUSG00000039130 79%

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Notes Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

Material Safety Data Sheet (MSDS)

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Validation
WB Validation

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.