Atlas Antibodies Anti-ZC3HC1 Antibody

상품 한눈에 보기

인간 ZC3HC1 단백질을 인식하는 토끼 폴리클로날 항체. IHC 및 WB에서 독립 항체 비교를 통한 검증 완료. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간, 랫드, 마우스 간 교차 반응성 확인.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA019089-100 Anti-ZC3HC1 Antibody, zinc finger, C3HC-type containing 1 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA019089-25 Anti-ZC3HC1 Antibody, zinc finger, C3HC-type containing 1 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: zinc finger, C3HC-type containing 1
Supplier: Atlas Antibodies

IHC (Immunohistochemistry): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.
WB (Western Blot): Validation of protein expression by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human ZC3HC1.

항목	내용
Target Protein	zinc finger, C3HC-type containing 1
Target Gene	ZC3HC1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	CEGQAFAVGVEKNWGAVVRSPEGTPQKIRQLIDEGIAPEEGGVDAKDTSATSQSVNGSPQAEQPSLESTSKEAFFSRVETFSSLKWAGKPFELSPLVCAKYGWV
Verified Species Reactivity	Human
Interspecies Identity	Rat ENSRNOG00000010154 (83%), Mouse ENSMUSG00000039130 (79%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative (Material Safety Data Sheet)