CacheBy
Atlas Antibodies Anti-ZBTB7B Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-ZBTB7B Antibody

상품 한눈에 보기

인간 ZBTB7B 단백질을 표적으로 하는 토끼 유래 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, 독립 항체 비교를 통한 검증 완료. PrEST 항원을 이용해 친화 정제된 고품질 항체로 다양한 연구에 활용 가능.

카탈로그번호
HPA006811-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA006811-100 Anti-ZBTB7B Antibody, zinc finger and BTB domain containing 7B 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA006811-25 Anti-ZBTB7B Antibody, zinc finger and BTB domain containing 7B 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-ZBTB7B Antibody

Anti-ZBTB7B Antibody

Target Protein: zinc finger and BTB domain containing 7B
Supplier: Atlas Antibodies

  • IHC (Independent validation): 단백질 발현 검증은 서로 다른 에피토프를 표적으로 하는 독립 항체 간 비교를 통해 수행됨
  • ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human ZBTB7B

Alternative Gene Names

c-Krox, hcKrox, ZBTB15, ZFP67, ZNF857B

Target Information

항목 내용
Target Protein zinc finger and BTB domain containing 7B
Target Gene ZBTB7B
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000020640 (83%), Mouse ENSMUSG00000028042 (82%)

Antigen Sequence:
AHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKII

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

Open Datasheet


제품 이미지

Enhanced Validation
IHC Independent
Independent Validation Tooltip
ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.