
Atlas Antibodies Anti-ZBTB7B Antibody
상품 한눈에 보기
인간 ZBTB7B 단백질을 표적으로 하는 토끼 유래 폴리클로날 항체. IHC 및 ICC 응용에 적합하며, 독립 항체 비교를 통한 검증 완료. PrEST 항원을 이용해 친화 정제된 고품질 항체로 다양한 연구에 활용 가능.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-ZBTB7B Antibody
Target Protein: zinc finger and BTB domain containing 7B
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Independent validation): 단백질 발현 검증은 서로 다른 에피토프를 표적으로 하는 독립 항체 간 비교를 통해 수행됨
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human ZBTB7B
Alternative Gene Names
c-Krox, hcKrox, ZBTB15, ZFP67, ZNF857B
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | zinc finger and BTB domain containing 7B |
| Target Gene | ZBTB7B |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000020640 (83%), Mouse ENSMUSG00000028042 (82%) |
Antigen Sequence:
AHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKII
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- 사용 전 부드럽게 혼합하십시오.
- 각 응용에 대한 최적 농도와 조건은 사용자가 직접 결정해야 합니다.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-ZBTB8A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZBTB7B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZBTB7B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZBTB6 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-ZBTB6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.