Atlas Antibodies Anti-ZBTB7B Antibody

상품 한눈에 보기

인간 ZBTB7B 단백질을 표적으로 하는 폴리클로날 항체로, IHC 및 ICC에 적합합니다. Rabbit 유래 IgG 형식이며, PrEST 항원으로 친화 정제되었습니다. 높은 종간 서열 일치도를 가지며, 신뢰성 높은 단백질 발현 검증에 활용됩니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA025820-100 Anti-ZBTB7B Antibody, zinc finger and BTB domain containing 7B 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA025820-25 Anti-ZBTB7B Antibody, zinc finger and BTB domain containing 7B 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: zinc finger and BTB domain containing 7B
Supplier: Atlas Antibodies

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human ZBTB7B.

c-Krox, hcKrox, ZBTB15, ZFP67, ZNF857B

Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence

AHPLTYEEEEVAGRVGSSGGSGPGDSYSPPTGTASPPEGPQSYEPYEGEEEEEELVYPPAYGLAQGGGPPLSPEELGSDEDAIDPDLMAYLSSLHQDNLAPGLDSQDKLVRKRRSQMPQECPVCHKII

Human

Interspecies Information:

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Notes	Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.