CacheBy
Atlas Antibodies Anti-XPC Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-XPC Antibody

상품 한눈에 보기

Human XPC 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. RAD4, XPCC 유전자 대체명으로 알려진 XPC를 표적하며, PrEST 항원을 이용해 친화 정제되었습니다. Human에 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA069673-100 Anti-XPC Antibody, xeroderma pigmentosum, complementation group C 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA069673-25 Anti-XPC Antibody, xeroderma pigmentosum, complementation group C 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-XPC Antibody

Anti-XPC Antibody

Target: xeroderma pigmentosum, complementation group C (XPC)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human XPC protein.


Alternative Gene Names

RAD4, XPCC

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein xeroderma pigmentosum, complementation group C
Target Gene XPC
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence EEEDAFEDEKPPKKSLLSKVSQGKRKRGCSHPGGSADGPAKKKVAKVTVKSENLKVIKDEALSDGDDLRDFPSDLKKAHHLKRGATMNEDSNEEEEESENDW

Verified Species Reactivity

Human


Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000030094 59%
Rat ENSRNOG00000008274 58%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

40% glycerol and PBS (pH 7.2).
Contains 0.02% sodium azide as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.