Atlas Antibodies Anti-XPNPEP1 Antibody

상품 한눈에 보기

Human XPNPEP1 단백질을 인식하는 고품질 폴리클로날 항체. WB, IHC, ICC 등 다양한 응용에 적합. Rabbit에서 생산된 IgG 항체로 PrEST 항원 기반 정제. 높은 종간 유사성 및 신뢰성 검증 완료.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA030420-100 Anti-XPNPEP1 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 1, soluble 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA030420-25 Anti-XPNPEP1 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 1, soluble 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

X-prolyl aminopeptidase (aminopeptidase P) 1, soluble 단백질을 인식하는 Human XPNPEP1 폴리클로날 항체입니다.

IHC (Immunohistochemistry)
WB (Western Blot)
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
ICC (Immunocytochemistry)

Polyclonal Antibody against Human XPNPEP1

XPNPEP, XPNPEPL, XPNPEPL1

항목	내용
Target Protein	X-prolyl aminopeptidase (aminopeptidase P) 1, soluble
Target Gene	XPNPEP1
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000025027 (93%), Rat ENSRNOG00000012084 (92%)

Antigen Sequence:
AIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCC

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand