CacheBy
Atlas Antibodies Anti-XPNPEP1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-XPNPEP1 Antibody

상품 한눈에 보기

Human XPNPEP1 단백질을 인식하는 고품질 폴리클로날 항체. WB, IHC, ICC 등 다양한 응용에 적합. Rabbit에서 생산된 IgG 항체로 PrEST 항원 기반 정제. 높은 종간 유사성 및 신뢰성 검증 완료.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA030420-100 Anti-XPNPEP1 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 1, soluble 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030420-25 Anti-XPNPEP1 Antibody, X-prolyl aminopeptidase (aminopeptidase P) 1, soluble 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-XPNPEP1 Antibody

Anti-XPNPEP1 Antibody

제품 개요

X-prolyl aminopeptidase (aminopeptidase P) 1, soluble 단백질을 인식하는 Human XPNPEP1 폴리클로날 항체입니다.

권장 응용 분야

  • IHC (Immunohistochemistry)
  • WB (Western Blot)
    Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
  • ICC (Immunocytochemistry)

제품 설명

Polyclonal Antibody against Human XPNPEP1

대체 유전자명

XPNPEP, XPNPEPL, XPNPEPL1

Open Datasheet

표적 정보

항목 내용
Target Protein X-prolyl aminopeptidase (aminopeptidase P) 1, soluble
Target Gene XPNPEP1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000025027 (93%), Rat ENSRNOG00000012084 (92%)

Antigen Sequence:
AIIGLETIMLFIDGDRIDAPSVKEHLLLDLGLEAEYRIQVHPYKSILSELKALCADLSPREKVWVSDKASYAVSETIPKDHRCC

항체 특성

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

사용 시 주의사항

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 조건에 맞는 최적 농도는 사용자가 직접 결정해야 합니다.

제품 이미지

Enhanced Validation
IHC Application
WB Validation
Independent Validation
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.