
Atlas Antibodies Anti-IGSF1 Antibody
상품 한눈에 보기
Human IGSF1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 유사성을 보입니다. 보존액으로 글리세롤 및 PBS를 포함합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IGSF1 Antibody
Target: Immunoglobulin superfamily member 1 (IGSF1)
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human IGSF1.
Alternative Gene Names
IGCD1, IGDC1, INHBP, KIAA0364, MGC75490, PGSF2
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Immunoglobulin superfamily member 1 |
| Target Gene | IGSF1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKVLELEAPGQLPKPIFWIQAETPALPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICRTHIQM |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000031111 (90%), Rat ENSRNOG00000007600 (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-IGSF9 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IGSF5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IGSF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IGSF10 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IGSF23 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.