
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-IGSF1 Antibody
상품 한눈에 보기
Human IGSF1 단백질을 인식하는 토끼 유래 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 높은 종간 서열 유사성을 보입니다. 보존액으로 글리세롤 및 PBS를 포함합니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA035582-100 Anti-IGSF1 Antibody, immunoglobulin superfamily, member 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035582-25 Anti-IGSF1 Antibody, immunoglobulin superfamily, member 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-IGSF1 Antibody
Anti-IGSF1 Antibody
Target: Immunoglobulin superfamily member 1 (IGSF1)
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human IGSF1.
Alternative Gene Names
IGCD1, IGDC1, INHBP, KIAA0364, MGC75490, PGSF2
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Immunoglobulin superfamily member 1 |
| Target Gene | IGSF1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | SRISSKFLLLKDKTQMTWIRPSHKTFQVSFLIGALTESNAGLYRCCYWKETGWSKPSKVLELEAPGQLPKPIFWIQAETPALPGCNVNILCHGWLQDLVFMLFKEGYAEPVDYQVPTGTMAIFSIDNLTPEDEGVYICRTHIQM |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000031111 (90%), Rat ENSRNOG00000007600 (88%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



