CacheBy
Atlas Antibodies Anti-IGSF23 Antibody
원본

Atlas Antibodies Anti-IGSF23 Antibody

상품 한눈에 보기

Human IGSF23 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형태입니다. IHC 및 ICC 응용에 적합하며, PrEST 항원으로 특이적 정제되었습니다. Human에 대해 검증되었으며, 40% glycerol 기반 PBS buffer에 보존됩니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA051811-100 Anti-IGSF23 Antibody, immunoglobulin superfamily, member 23 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA051811-25 Anti-IGSF23 Antibody, immunoglobulin superfamily, member 23 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IGSF23 Antibody

Anti-IGSF23 Antibody

Target: Immunoglobulin superfamily, member 23 (IGSF23)
Supplier: Atlas Antibodies

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal Antibody against Human IGSF23

Open Datasheet

Target Information

  • Target Protein: Immunoglobulin superfamily, member 23
  • Target Gene: IGSF23
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
PTTTTDPMLEKDAAGGDFPANLVLQLMPLKTFPAAIRGVIQSELNYSVILQWVVTMDPEPVLSWTFSGVPCGMGEKLFIRRLS

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000040498 53%
Rat ENSRNOG00000024630 48%

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
ICC Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.