
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-IGFBP1 Antibody
상품 한눈에 보기
인슐린유사 성장인자 결합 단백질 1(IGFBP1)을 표적하는 폴리클로날 항체로, 인간 시료에 적합합니다. IHC 및 ICC 응용에 권장되며, RNA-seq 데이터와 비교한 정교한 단백질 발현 검증(Orthogonal Validation)을 제공합니다. 친화성 정제된 고품질 항체입니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA050640-100 Anti-IGFBP1 Antibody, insulin-like growth factor binding protein 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA050640-25 Anti-IGFBP1 Antibody, insulin-like growth factor binding protein 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-IGFBP1 Antibody
Anti-IGFBP1 Antibody
Target: Insulin-like growth factor binding protein 1 (IGFBP1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human IGFBP1.
Alternative Gene Names
AFBP, hIGFBP-1, IBP1, IGF-BP25, PP12
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Insulin-like growth factor binding protein 1 |
| Target Gene | IGFBP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | QQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGS |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000058780 (56%), Mouse ENSMUSG00000020429 (55%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



