
Atlas Antibodies Anti-IGFBP1 Antibody
상품 한눈에 보기
인슐린유사 성장인자 결합 단백질 1(IGFBP1)을 표적하는 폴리클로날 항체로, 인간 시료에 적합합니다. IHC 및 ICC 응용에 권장되며, RNA-seq 데이터와 비교한 정교한 단백질 발현 검증(Orthogonal Validation)을 제공합니다. 친화성 정제된 고품질 항체입니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IGFBP1 Antibody
Target: Insulin-like growth factor binding protein 1 (IGFBP1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Orthogonal Validation): Protein expression validated by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- ICC (Immunocytochemistry)
Product Description
Polyclonal antibody against human IGFBP1.
Alternative Gene Names
AFBP, hIGFBP-1, IBP1, IGF-BP25, PP12
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | Insulin-like growth factor binding protein 1 |
| Target Gene | IGFBP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | QQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGS |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000058780 (56%), Mouse ENSMUSG00000020429 (55%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-IGFBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IGFBP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IGFBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IGFALS Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IGFALS Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.