Atlas Antibodies Anti-IGFALS Antibody

상품 한눈에 보기

Human IGFALS 단백질을 표적으로 하는 Rabbit Polyclonal 항체로, IHC, WB, ICC에 적합합니다. PrEST 항원을 이용한 친화 정제 방식으로 제조되었으며, 다양한 종 간 교차 반응성이 검증되었습니다. 연구용 단백질 발현 분석에 적합합니다.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA040948-100 Anti-IGFALS Antibody, insulin-like growth factor binding protein, acid labile subunit 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA040948-25 Anti-IGFALS Antibody, insulin-like growth factor binding protein, acid labile subunit 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

insulin-like growth factor binding protein, acid labile subunit

Validation Note:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal Antibody against Human IGFALS

항목	내용
Target Protein	insulin-like growth factor binding protein, acid labile subunit
Target Gene	IGFALS
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	DCGCPLKALRDFALQNPSAVPRFVQAICEGDDCQPPAYTYNNITCASPPEVVGLDLRDLSEAHFAP

종	유전자 ID	항원 서열 일치율
Rat	ENSRNOG00000015061	77%
Mouse	ENSMUSG00000046070	76%

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS	Material Safety Data Sheet