
Atlas Antibodies Anti-IGF2BP1 Antibody
상품 한눈에 보기
Human IGF2BP1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합합니다. Orthogonal validation을 통해 RNA-seq 데이터와 비교 검증되었으며, 고순도의 Affinity purification 방식으로 제조되었습니다. 연구용으로 신뢰성 높은 단백질 발현 분석에 활용 가능합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-IGF2BP1 Antibody
Target: insulin-like growth factor 2 mRNA binding protein 1 (IGF2BP1)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry): Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
- WB (Western Blot): Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines.
Product Description
Polyclonal Antibody against Human IGF2BP1
Alternative Gene Names
- IMP-1
Specifications
| 항목 | 내용 |
|---|---|
| Target Protein | insulin-like growth factor 2 mRNA binding protein 1 |
| Target Gene | IGF2BP1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DVAAMSLQSHLIPGLNLAAVGLFPASSSAVPPPPSSVTGAAPYSSFMQAPEQEMVQVFIPAQAVGAIIGKK |
| Verified Species Reactivity | Human |
| Interspecies Information | Mouse ENSMUSG00000013415 (100%), Rat ENSRNOG00000006122 (99%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet) |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-IGF1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IGF2BP2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IGF2BP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IGF2BP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-IGDCC4 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.