CacheBy
Atlas Antibodies Anti-IGF1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-IGF1 Antibody

상품 한눈에 보기

인슐린 유사 성장인자 1(IGF1)을 인식하는 토끼 폴리클로날 항체로, 인간 시료에 적합합니다. PrEST 항원을 이용해 친화정제되었으며, IHC 등 다양한 응용에 사용 가능합니다. 글리세롤 버퍼에 보존되어 안정적입니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA048946-100 Anti-IGF1 Antibody, insulin-like growth factor 1 (somatomedin C) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048946-25 Anti-IGF1 Antibody, insulin-like growth factor 1 (somatomedin C) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-IGF1 Antibody

Anti-IGF1 Antibody

Target: insulin-like growth factor 1 (somatomedin C)

  • Immunohistochemistry (IHC)

Product Description

Polyclonal antibody against Human IGF1.

Alternative Gene Names

  • IGF-I
  • IGF1A
  • IGFI

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein insulin-like growth factor 1 (somatomedin C)
Target Gene IGF1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence CFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKNYRM
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000004517 (93%), Mouse ENSMUSG00000020053 (91%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.