
Thermo Fisher Scientific Human IFN-gamma Recombinant Protein
인간 유래 IFN-gamma 재조합 단백질로 면역 반응 연구용에 적합. E. coli 발현 시스템에서 생산되며 순도 ≥95%, 엔도톡신 ≤0.1 EU/µg. 항바이러스 및 면역 조절 연구에 활용 가능. 동결건조 형태로 제공되며 -20°C 보관 권장.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Applications
- Control (Ctrl): Assay-dependent
Product Specifications
| 항목 | 내용 |
|---|---|
| Species | Human |
| Expression System | E. coli |
| Amino Acid Sequence | MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRRKRSQMLFQGRRASQ |
| Molecular Weight | 16.9 kDa |
| Class | Recombinant |
| Type | Protein |
| Purity | ≥95% |
| Endotoxin Concentration | ≤0.1 EU/µg |
| Activity | ED50 <0.75 ng/mL (Viral challenge assay using EMC virus on A549 cells) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.1 mg/mL |
| Purification | Purified |
| Storage Buffer | 10 mM sodium phosphate, pH 7.5, with 50 mM NaCl |
| Contains | No preservative |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
Product Specific Information
Recombinant human IFN-gamma is a non-glycosylated protein containing 144 amino acids.
Reconstitute using sterile water at 0.1 mg/mL and centrifuge prior to opening vial. Gently pipet solution down the sides of the vial. Do not vortex the sample.
Store reconstituted material at -20°C and add 0.1% BSA for additional stability.
Target Information
IFN-gamma (Interferon gamma, Type II interferon) is a macrophage activation factor and immune interferon produced primarily by T-lymphocytes and natural killer cells in response to antigens, mitogens, Staphylococcus enterotoxin B, phytohemagglutinin, and other cytokines.
It is a dimeric protein consisting of two 146 amino acid subunits and functions as a homodimer (~45 kDa). On SDS-PAGE, IFN-gamma appears as 25, 20, and minor 15.5 kDa bands due to differential glycosylation.
Human IFN-gamma is species-specific and does not cross-react with mouse IFN-gamma.
Functions:
- Antiviral and tumor antiproliferative activity
- Induction of class I and II MHC
- Macrophage activation
- Enhancement of immunoglobulin secretion by B lymphocytes
- Cytokine regulation and synergistic action with other cytokines
Activation occurs through binding to IFN-gamma receptor I and II, activating the JAK-STAT pathway.
Human IFN-gamma shares about 40% sequence homology with mouse IFN-gamma.
Expression is upregulated by IL-2, FGF basic, EGF, and downregulated by vitamin D3 or DMN.
Mutations in the IFN-gamma gene are associated with aplastic anemia.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
🏷️Thermo Fisher Scientific 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Thermo Fisher Scientific
Thermo Fisher Scientific Human IL-16 Recombinant Protein
598,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Human Galectin-1 Recombinant Protein
598,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Human IFN-gamma Recombinant Protein
560,200원

Thermo Fisher Scientific
Thermo Fisher Scientific Human FGF-basic (FGF-2/bFGF) (147 aa) Recombinant Protein
598,000원

Thermo Fisher Scientific
Thermo Fisher Scientific Mouse IL-16 Recombinant Protein
546,500원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|