Thermo Fisher Scientific Human IFN-gamma Recombinant Protein
인간 유래 IFN-gamma 재조합 단백질로 면역 반응 연구용에 적합. E. coli 발현 시스템에서 생산되며 순도 ≥95%, 엔도톡신 ≤0.1 EU/µg. 항바이러스 및 면역 조절 연구에 활용 가능. 동결건조 형태로 제공되며 -20°C 보관 권장.
- 카탈로그번호
- RP8607
- 카테고리
- Protein
- 판매단위
- pk
카탈로그
1개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다Thermo Fisher Scientific · Thermo Fisher Scientific Human IFN-gamma Recombinant Protein
Applications
- Control (Ctrl): Assay-dependent
Product Specifications
| 항목 | 내용 |
|---|---|
| Species | Human |
| Expression System | E. coli |
| Amino Acid Sequence | MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRRKRSQMLFQGRRASQ |
| Molecular Weight | 16.9 kDa |
| Class | Recombinant |
| Type | Protein |
| Purity | ≥95% |
| Endotoxin Concentration | ≤0.1 EU/µg |
| Activity | ED50 <0.75 ng/mL (Viral challenge assay using EMC virus on A549 cells) |
| Conjugate | Unconjugated |
| Form | Lyophilized |
| Concentration | 0.1 mg/mL |
| Purification | Purified |
| Storage Buffer | 10 mM sodium phosphate, pH 7.5, with 50 mM NaCl |
| Contains | No preservative |
| Storage Conditions | -20°C, Avoid Freeze/Thaw Cycles |
| Shipping Conditions | Wet ice |
Product Specific Information
Recombinant human IFN-gamma is a non-glycosylated protein containing 144 amino acids.
Reconstitute using sterile water at 0.1 mg/mL and centrifuge prior to opening vial. Gently pipet solution down the sides of the vial. Do not vortex the sample.
Store reconstituted material at -20°C and add 0.1% BSA for additional stability.
Target Information
IFN-gamma (Interferon gamma, Type II interferon) is a macrophage activation factor and immune interferon produced primarily by T-lymphocytes and natural killer cells in response to antigens, mitogens, Staphylococcus enterotoxin B, phytohemagglutinin, and other cytokines.
It is a dimeric protein consisting of two 146 amino acid subunits and functions as a homodimer (~45 kDa). On SDS-PAGE, IFN-gamma appears as 25, 20, and minor 15.5 kDa bands due to differential glycosylation.
Human IFN-gamma is species-specific and does not cross-react with mouse IFN-gamma.
Functions:
- Antiviral and tumor antiproliferative activity
- Induction of class I and II MHC
- Macrophage activation
- Enhancement of immunoglobulin secretion by B lymphocytes
- Cytokine regulation and synergistic action with other cytokines
Activation occurs through binding to IFN-gamma receptor I and II, activating the JAK-STAT pathway.
Human IFN-gamma shares about 40% sequence homology with mouse IFN-gamma.
Expression is upregulated by IL-2, FGF basic, EGF, and downregulated by vitamin D3 or DMN.
Mutations in the IFN-gamma gene are associated with aplastic anemia.
For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.
Thermo Fisher Scientific 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.