Thermo Fisher Scientific Human IFN-gamma Recombinant Protein

Thermo Fisher Scientific Human IFN-gamma Recombinant Protein

상품 한눈에 보기

인간 유래 IFN-gamma 재조합 단백질로 면역 반응 연구용에 적합. E. coli 발현 시스템에서 생산되며 순도 ≥95%, 엔도톡신 ≤0.1 EU/µg. 항바이러스 및 면역 조절 연구에 활용 가능. 동결건조 형태로 제공되며 -20°C 보관 권장.

상품 옵션 정보

다양한 옵션의 상품 정보와 가격을 확인하세요

마지막 업데이트
2025. 07. 31. 오후 12:58
소모품
RP8607
Thermo Fisher Scientific RP8607 Human IFN-gamma Recombinant Protein 100 ug pk
CAS: -단위: pk
재고보유재고: 1
560,200
(VAT포함)616,220
소모품
RP8607
재고보유재고: 1
Thermo Fisher Scientific RP8607 Human IFN-gamma Recombinant Protein 100 ug pk
CAS: -단위: pk
560,200
(VAT포함)616,220

AI 추천 연관 상품

AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요

연관 상품을 찾고 있습니다...

Applications

  • Control (Ctrl): Assay-dependent

Product Specifications

항목 내용
Species Human
Expression System E. coli
Amino Acid Sequence MQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRRKRSQMLFQGRRASQ
Molecular Weight 16.9 kDa
Class Recombinant
Type Protein
Purity ≥95%
Endotoxin Concentration ≤0.1 EU/µg
Activity ED50 <0.75 ng/mL (Viral challenge assay using EMC virus on A549 cells)
Conjugate Unconjugated
Form Lyophilized
Concentration 0.1 mg/mL
Purification Purified
Storage Buffer 10 mM sodium phosphate, pH 7.5, with 50 mM NaCl
Contains No preservative
Storage Conditions -20°C, Avoid Freeze/Thaw Cycles
Shipping Conditions Wet ice

Product Specific Information

Recombinant human IFN-gamma is a non-glycosylated protein containing 144 amino acids.
Reconstitute using sterile water at 0.1 mg/mL and centrifuge prior to opening vial. Gently pipet solution down the sides of the vial. Do not vortex the sample.
Store reconstituted material at -20°C and add 0.1% BSA for additional stability.

Target Information

IFN-gamma (Interferon gamma, Type II interferon) is a macrophage activation factor and immune interferon produced primarily by T-lymphocytes and natural killer cells in response to antigens, mitogens, Staphylococcus enterotoxin B, phytohemagglutinin, and other cytokines.
It is a dimeric protein consisting of two 146 amino acid subunits and functions as a homodimer (~45 kDa). On SDS-PAGE, IFN-gamma appears as 25, 20, and minor 15.5 kDa bands due to differential glycosylation.
Human IFN-gamma is species-specific and does not cross-react with mouse IFN-gamma.

Functions:

  • Antiviral and tumor antiproliferative activity
  • Induction of class I and II MHC
  • Macrophage activation
  • Enhancement of immunoglobulin secretion by B lymphocytes
  • Cytokine regulation and synergistic action with other cytokines

Activation occurs through binding to IFN-gamma receptor I and II, activating the JAK-STAT pathway.
Human IFN-gamma shares about 40% sequence homology with mouse IFN-gamma.
Expression is upregulated by IL-2, FGF basic, EGF, and downregulated by vitamin D3 or DMN.
Mutations in the IFN-gamma gene are associated with aplastic anemia.

For Research Use Only. Not for use in diagnostic procedures. Not for resale without express authorization.


배송/결제/교환/반품 안내

배송 정보

기본 배송비
  • - 배송비 3,850원 (부가세 포함)
  • - 10만원 이상 구매시 배송비 무료
  • - 도서산간 및 제주를 포함한 일부 지역 추가비용 발생
  • - 장비의 경우 추가 배송비 및 설치비가 청구 될 수 있습니다
교환/반품 배송비
  • - 상품 별로 상이
착불 배송비
  • - 착불 적용 상품에 개별 부과 (상품 별로 상이)
교환/반품 배송비
  • - 상품 별로 상이

결제 및 환불 안내

결제수단
  • - 신용카드
  • - 가상계좌
  • - 연구비카드
  • - 세금계산서 (기업은행 033-502993-01-019)
  • - 세금계산서 (신한은행 100-032-703829)
  • - 상품 결제 후 최대 60일 이내 제공 완료
취소
  • - 취소 접수 후 3 ~ 5일 이내 환불 처리
반품
  • - 반품 접수 후 3 ~ 5일 이내 환불 처리
환급
  • - 회사는 회원이 구매신청한 상품 등이 품절 등의 사유로 인도 또는 제공할 수 없을 때에는 지체 없이 그 사유를 회원에게 통지하고,
      사전에 상품 등의 대금을 받은 경우에는 대금을 받은 날로부터 3영업일 이내에 환급하거나 환급에 필요한 조치를 취합니다.

교환 및 반품 접수

교환 및 반품 접수 기한
  • - 상품 수령일로부터 7일 이내
교환 및 반품 접수가 가능한 경우
  • - 제품의 하자는 없지만, 다른 상품으로 교환하거나 반품 원하는 경우
     (배송비 고객 부담)
  • - 상품자체 불량 및 하자에 의한 경우
  • - 상품 오배송에 의한 경우
교환 및 반품 접수가 불가능한 경우
  • - 상품 수령 후 7일을 초과한 경우
  • - 개별 포장 상품의 포장을 훼손한 경우
  • - 고객의 고의적인 귀책으로 상품가치가 훼손된 경우
  • - 주문제작을 통해서 제품을 생산하는 경우
  • - 주문 당시 재고가 없어서 해외를 통해 제품을 수입해서 구매하는 경우

교환 및 반품 신청

교환 절차
  • - 상품 불량/오배송/상품파손
  • - 전화(02-585-1342) 또는 info@cacheby.com에 상품교환 접수
반품 절차
  • - 반품할 품목을 확인 후 info@cacheby.com로 반품 신청 (수령 후 7일 이내 가능하며 이후 불가)
  • - 전달드린 주문번호와 함께 반품 상품을 포장
     (포장을 꼼꼼하게 해주셔야 반품 상품 손상에 따른 불이익이 없습니다.)
  • - 택배회사 방문 시 반품 상품 전달
     (택배사의 반송장은 상품 교환이 완료될 때까지 보관해주시기 바랍니다.)
  • - 회수된 제품 확인 후 하자없을시 배송비를 제외하고 환불 처리 진행
     (환불 처리 후 입금까지 최대 2주까지 소요될 수 있습니다.)

문의 0