
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-HEXB Antibody
상품 한눈에 보기
인간 HEXB 단백질을 인식하는 폴리클로날 항체로, 독립 항체 비교를 통한 IHC 검증 완료. 토끼 유래 IgG 형태이며, PrEST 항원을 이용해 친화 정제됨. 인간에 특이적으로 반응하며, 연구용으로 적합.
- 카탈로그번호
- HPA056010-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA056010-100 Anti-HEXB Antibody, hexosaminidase B (beta polypeptide) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056010-25 Anti-HEXB Antibody, hexosaminidase B (beta polypeptide) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-HEXB Antibody
Anti-HEXB Antibody
Target: hexosaminidase B (beta polypeptide)
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against human HEXB.
Open Datasheet
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | hexosaminidase B (beta polypeptide) |
| Target Gene | HEXB |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000025274 (60%), Mouse ENSMUSG00000021665 (60%) |
Antigen Sequence:
PSVSAKPGPALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYI
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



