Atlas Antibodies Anti-HEXB Antibody

상품 한눈에 보기

Human HEXB 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 등 단백질 발현 검증에 적합. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤/PBS 완충액에 보존. 사람에 특이적으로 반응하며, 마우스·랫과 60% 항원 서열 일치.

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA055409-100 Anti-HEXB Antibody, hexosaminidase B (beta polypeptide) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA055409-25 Anti-HEXB Antibody, hexosaminidase B (beta polypeptide) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Target: hexosaminidase B (beta polypeptide)
Supplier: Atlas Antibodies

Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.

Polyclonal antibody against human HEXB.
Open Datasheet

항목	내용
Target Protein	hexosaminidase B (beta polypeptide)
Target Gene	HEXB
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence	PSVSAKPGPALWPLPLSVKMTPNLLHLAPENFYISHSPNSTAGPSCTLLEEAFRRYHGYI
Verified Species Reactivity	Human
Interspecies Homology	Mouse ENSMUSG00000021665 (60%), Rat ENSRNOG00000025274 (60%)

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Purification Method	Affinity purified using the PrEST antigen as affinity ligand
Buffer Composition	40% glycerol and PBS (pH 7.2), 0.02% sodium azide as preservative
MSDS	Material Safety Data Sheet