Atlas Antibodies Anti-GRK2 Antibody

상품 한눈에 보기

Rabbit polyclonal antibody targeting human GRK2 (G protein-coupled receptor kinase 2). High sequence identity with rat and mouse orthologs. Affinity purified using PrEST antigen. Suitable for various immunoassays.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA048330-100 Anti-GRK2 Antibody, G protein-coupled receptor kinase 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA048330-25 Anti-GRK2 Antibody, G protein-coupled receptor kinase 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GRK2 Antibody

Anti-GRK2 Antibody

Target Information

Target Protein: G protein-coupled receptor kinase 2
Target Gene: GRK2
Alternative Gene Names: ADRBK1, BARK1

Product Description

Polyclonal antibody against human GRK2. Affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL

Verified Species Reactivity

Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

Rat (ENSRNOG00000018985): 98%
Mouse (ENSMUSG00000024858): 98%

Recommended Applications

Immunocytochemistry (ICC)

Specifications

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using PrEST antigen
Storage Notes	Gently mix before use. Determine optimal concentrations and conditions for each application.