
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GRK2 Antibody
상품 한눈에 보기
Rabbit polyclonal antibody targeting human GRK2 (G protein-coupled receptor kinase 2). High sequence identity with rat and mouse orthologs. Affinity purified using PrEST antigen. Suitable for various immunoassays.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA048330-100 Anti-GRK2 Antibody, G protein-coupled receptor kinase 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048330-25 Anti-GRK2 Antibody, G protein-coupled receptor kinase 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GRK2 Antibody
Anti-GRK2 Antibody
Target Information
- Target Protein: G protein-coupled receptor kinase 2
- Target Gene: GRK2
- Alternative Gene Names: ADRBK1, BARK1
Product Description
Polyclonal antibody against human GRK2. Affinity purified using the PrEST antigen as affinity ligand.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:LVQWKKELRDAYREAQQLVQRVPKMKNKPRSPVVELSKVPLVQRGSANGL
Verified Species Reactivity
Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat (ENSRNOG00000018985): 98%
- Mouse (ENSMUSG00000024858): 98%
Recommended Applications
Immunocytochemistry (ICC)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative) |
| Purification Method | Affinity purified using PrEST antigen |
| Storage Notes | Gently mix before use. Determine optimal concentrations and conditions for each application. |
Additional Information
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



