CacheBy
Atlas Antibodies Anti-GRK1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GRK1 Antibody

상품 한눈에 보기

인간 GRK1 단백질을 표적으로 하는 폴리클로날 항체로, 독립 항체 검증을 통해 IHC에서 단백질 발현을 확인함. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용한 친화 정제 방식으로 제조됨. Human 반응성 확인 및 높은 종간 서열 유사성 보유.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA035200-100 Anti-GRK1 Antibody, G protein-coupled receptor kinase 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA035200-25 Anti-GRK1 Antibody, G protein-coupled receptor kinase 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GRK1 Antibody

Anti-GRK1 Antibody

Target: G protein-coupled receptor kinase 1 (GRK1)
Supplier: Atlas Antibodies


Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human GRK1


Alternative Gene Names

GPRK1, RHOK, RK


Target Information

항목 내용
Target Protein G protein-coupled receptor kinase 1
Target Gene GRK1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000031450 (85%), Rat ENSRNOG00000018430 (82%)

Antigen Sequence:
MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSA


Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative
Safety Data Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Additional Resources

Open Datasheet (PDF)


제품 이미지

Enhanced Validation
IHC Independent Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.