
Atlas Antibodies Anti-GRK1 Antibody
상품 한눈에 보기
인간 GRK1 단백질을 표적으로 하는 폴리클로날 항체로, 독립 항체 검증을 통해 IHC에서 단백질 발현을 확인함. Rabbit 유래 IgG 항체이며, PrEST 항원을 이용한 친화 정제 방식으로 제조됨. Human 반응성 확인 및 높은 종간 서열 유사성 보유.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GRK1 Antibody
Target: G protein-coupled receptor kinase 1 (GRK1)
Supplier: Atlas Antibodies
Recommended Applications
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human GRK1
Alternative Gene Names
GPRK1, RHOK, RK
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | G protein-coupled receptor kinase 1 |
| Target Gene | GRK1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000031450 (85%), Rat ENSRNOG00000018430 (82%) |
Antigen Sequence:
MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSA
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative |
| Safety Data | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Additional Resources
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GRK3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRK2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRK1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRIPAP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRIPAP1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.