CacheBy
Atlas Antibodies Anti-GRIK2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GRIK2 Antibody

상품 한눈에 보기

Human GRIK2 단백질을 인식하는 Rabbit Polyclonal Antibody. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 적합. Human, Rat, Mouse 종에서 반응 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA014623-100 Anti-GRIK2 Antibody, glutamate receptor, ionotropic, kainate 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014623-25 Anti-GRIK2 Antibody, glutamate receptor, ionotropic, kainate 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GRIK2 Antibody

Anti-GRIK2 Antibody

Target Information

  • Target Protein: Glutamate receptor, ionotropic, kainate 2
  • Target Gene: GRIK2
  • Alternative Gene Names: GluK2, GLUR6, MRT6

Product Description

Polyclonal antibody against human GRIK2, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
LEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKE

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

  • Rat ENSRNOG00000000368 (100%)
  • Mouse ENSMUSG00000056073 (100%)

Immunohistochemistry (IHC)

Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method Affinity purified using PrEST antigen
Storage Store at recommended temperature; mix gently before use
Safety Information Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Datasheet

Open Datasheet (PDF)

제품 이미지

Recommended Applications - IHC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.