
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GRIK2 Antibody
상품 한눈에 보기
Human GRIK2 단백질을 인식하는 Rabbit Polyclonal Antibody. Affinity purification으로 높은 특이성과 재현성 확보. IHC 등 다양한 응용에 적합. Human, Rat, Mouse 종에서 반응 검증됨.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA014623-100 Anti-GRIK2 Antibody, glutamate receptor, ionotropic, kainate 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA014623-25 Anti-GRIK2 Antibody, glutamate receptor, ionotropic, kainate 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GRIK2 Antibody
Anti-GRIK2 Antibody
Target Information
- Target Protein: Glutamate receptor, ionotropic, kainate 2
- Target Gene: GRIK2
- Alternative Gene Names: GluK2, GLUR6, MRT6
Product Description
Polyclonal antibody against human GRIK2, produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Antigen Sequence
Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:LEKRSFCSAMVEELRMSLKCQRRLKHKPQAPVIVKTEEVINMHTFNDRRLPGKE
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to the following orthologs:
- Rat ENSRNOG00000000368 (100%)
- Mouse ENSMUSG00000056073 (100%)
Recommended Applications
Immunohistochemistry (IHC)
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using PrEST antigen |
| Storage | Store at recommended temperature; mix gently before use |
| Safety Information | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



