Atlas Antibodies Anti-GRID2 Antibody

상품 한눈에 보기

Human GRID2 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증을 통해 RNA-seq 데이터와 비교하여 단백질 발현을 확인함. GluD2/GluR-delta-2 대체명으로 알려진 타깃을 특이적으로 검출하며, PrEST 항원으로 친화 정제됨. 다양한 조직 연구에 적합.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA058538-100 Anti-GRID2 Antibody, glutamate receptor, ionotropic, delta 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA058538-25 Anti-GRID2 Antibody, glutamate receptor, ionotropic, delta 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GRID2 Antibody

Anti-GRID2 Antibody

Target: glutamate receptor, ionotropic, delta 2
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human GRID2

Alternative Gene Names

GluD2
GluR-delta-2

Open Datasheet

Target Information

항목	내용
Target Protein	glutamate receptor, ionotropic, delta 2
Target Gene	GRID2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Information	Rat ENSRNOG00000006174 (99%), Mouse ENSMUSG00000071424 (99%)

Antigen Sequence Detail:
RVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSIDLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDR

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide (preservative)
Purification Method	Affinity purified using the PrEST antigen as affinity ligand