CacheBy
Atlas Antibodies Anti-GRID2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GRID2 Antibody

상품 한눈에 보기

Human GRID2 단백질을 인식하는 폴리클로날 항체로, IHC Orthogonal 검증 완료. Rabbit에서 생산된 IgG 형 항체이며, 40% glycerol/PBS buffer에 보존. GluD2, GluR-delta-2 대체명으로 알려진 glutamate receptor, ionotropic, delta 2 타겟.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA056253-100 Anti-GRID2 Antibody, glutamate receptor, ionotropic, delta 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA056253-25 Anti-GRID2 Antibody, glutamate receptor, ionotropic, delta 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GRID2 Antibody

Anti-GRID2 Antibody

Target: glutamate receptor, ionotropic, delta 2
Supplier: Atlas Antibodies

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human GRID2

Alternative Gene Names

  • GluD2
  • GluR-delta-2

Open Datasheet

Target Information

항목 내용
Target Protein glutamate receptor, ionotropic, delta 2
Target Gene GRID2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000006174 (99%)
Mouse ENSMUSG00000071424 (99%)

Clonality and Host

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

Antigen Sequence

RVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSIDLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDR

제품 이미지

Enhanced Validation
IHC Orthogonal
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.