
Atlas Antibodies Anti-GRID2 Antibody
Human GRID2 단백질을 인식하는 폴리클로날 항체로, IHC Orthogonal 검증 완료. Rabbit에서 생산된 IgG 형 항체이며, 40% glycerol/PBS buffer에 보존. GluD2, GluR-delta-2 대체명으로 알려진 glutamate receptor, ionotropic, delta 2 타겟.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GRID2 Antibody
Target: glutamate receptor, ionotropic, delta 2
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human GRID2
Alternative Gene Names
- GluD2
- GluR-delta-2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glutamate receptor, ionotropic, delta 2 |
| Target Gene | GRID2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000006174 (99%) Mouse ENSMUSG00000071424 (99%) |
Clonality and Host
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
| 구성 | 내용 |
|---|---|
| Buffer | 40% glycerol and PBS (pH 7.2) |
| Preservative | 0.02% sodium azide |
| MSDS | Material Safety Data Sheet |
Purification Method
Affinity purified using the PrEST antigen as affinity ligand
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Antigen Sequence
RVPSKEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSIDLTPLDIDTLPTRQALEQISDFRNTHITTTTFIPEQIQTLSRTLSAKAASGFTFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSIPYQPTPTLGLNLGNDPDR
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GRID2IP Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRIA3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRID2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRIA3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRHL2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|