CacheBy
Atlas Antibodies Anti-GRID2IP Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-GRID2IP Antibody

상품 한눈에 보기

Human GRID2IP 단백질을 인식하는 토끼 폴리클로날 항체로, IHC 및 WB에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, 40% 글리세롤 및 PBS 완충액에 보존됩니다. 사람에 대해 검증되었으며, 생쥐 및 랫트와 97% 서열 동일성을 가집니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA045381-100 Anti-GRID2IP Antibody, glutamate receptor, ionotropic, delta 2 (Grid2) interacting protein 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA045381-25 Anti-GRID2IP Antibody, glutamate receptor, ionotropic, delta 2 (Grid2) interacting protein 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-GRID2IP Antibody

Anti-GRID2IP Antibody

Target: glutamate receptor, ionotropic, delta 2 (Grid2) interacting protein
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against Human GRID2IP.

Open Datasheet (PDF)


Target Information

  • Target Protein: glutamate receptor, ionotropic, delta 2 (Grid2) interacting protein
  • Target Gene: GRID2IP
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
SETSHMSVKRLRWEQVENSEGTIWGQLGEDSDYDKLSDMVKYLDLELHFGTQKPAKPVPGPEPFRKKEVVEILSHKKAYNTSILLAHLKLSPAELRQVLMSMEP

Verified Species Reactivity

  • Human

Interspecies Information

Species Gene ID Sequence Identity
Mouse ENSMUSG00000010825 97%
Rat ENSRNOG00000030927 97%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 최적의 농도 및 조건은 사용자가 실험에 맞게 결정해야 합니다.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.