
원본
Atlas Antibodies Anti-GRIA2 Antibody
상품 한눈에 보기
Human GRIA2 단백질을 인식하는 rabbit polyclonal antibody로, IHC orthogonal validation을 통해 검증됨. AMPA 타입 글루탐산 수용체 연구에 적합하며, 높은 종간 교차 반응성과 정제된 품질을 제공. 연구용으로 최적화된 고순도 항체.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA008441-100 Anti-GRIA2 Antibody, glutamate receptor, ionotropic, AMPA 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA008441-25 Anti-GRIA2 Antibody, glutamate receptor, ionotropic, AMPA 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GRIA2 Antibody
Anti-GRIA2 Antibody
Target: glutamate receptor, ionotropic, AMPA 2
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human GRIA2
Alternative Gene Names
- GluA2
- GLUR2
- GLURB
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glutamate receptor, ionotropic, AMPA 2 |
| Target Gene | GRIA2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000033981 (100%), Rat ENSRNOG00000054204 (99%) |
Antigen Sequence:
NLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLA
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



