
Atlas Antibodies Anti-GRIA2 Antibody
Human GRIA2 단백질을 인식하는 rabbit polyclonal antibody로, IHC orthogonal validation을 통해 검증됨. AMPA 타입 글루탐산 수용체 연구에 적합하며, 높은 종간 교차 반응성과 정제된 품질을 제공. 연구용으로 최적화된 고순도 항체.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GRIA2 Antibody
Target: glutamate receptor, ionotropic, AMPA 2
Supplier: Atlas Antibodies
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human GRIA2
Alternative Gene Names
- GluA2
- GLUR2
- GLURB
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glutamate receptor, ionotropic, AMPA 2 |
| Target Gene | GRIA2 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse ENSMUSG00000033981 (100%), Rat ENSRNOG00000054204 (99%) |
Antigen Sequence:
NLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLA
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GRIA3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRHL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRIA2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRIA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRHPR Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|