원본

Atlas Antibodies Anti-GRIA2 Antibody

상품 한눈에 보기

Human GRIA2 단백질을 인식하는 rabbit polyclonal antibody로, IHC orthogonal validation을 통해 검증됨. AMPA 타입 글루탐산 수용체 연구에 적합하며, 높은 종간 교차 반응성과 정제된 품질을 제공. 연구용으로 최적화된 고순도 항체.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA008441-100 Anti-GRIA2 Antibody, glutamate receptor, ionotropic, AMPA 2 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA008441-25 Anti-GRIA2 Antibody, glutamate receptor, ionotropic, AMPA 2 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-GRIA2 Antibody

Anti-GRIA2 Antibody

Target: glutamate receptor, ionotropic, AMPA 2
Supplier: Atlas Antibodies

Recommended Applications

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human GRIA2

Alternative Gene Names

GluA2
GLUR2
GLURB

Open Datasheet

Target Information

항목	내용
Target Protein	glutamate receptor, ionotropic, AMPA 2
Target Gene	GRIA2
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Verified Species Reactivity	Human
Interspecies Identity	Mouse ENSMUSG00000033981 (100%), Rat ENSRNOG00000054204 (99%)

Antigen Sequence:
NLRKQRIEISRRGNAGDCLANPAVPWGQGVEIERALKQVQVEGLSGNIKFDQNGKRINYTINIMELKTNGPRKIGYWSEVDKMVVTLTELPSGNDTSGLENKTVVVTTILESPYVMMKKNHEMLEGNERYEGYCVDLA

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
Purification Method	Affinity purified using the PrEST antigen as affinity ligand