Atlas Antibodies Anti-GRIA1 Antibody

Anti-GRIA1 Antibody

제품 개요

• Target Protein: Glutamate receptor, ionotropic, AMPA 1
• Target Gene: GRIA1
• Alternative Gene Names: GluA1, GLUR1, GLURA
• Clonality: Polyclonal
• Host: Rabbit
• Isotype: IgG

제품 설명

Polyclonal antibody against human GRIA1.
Recommended for immunohistochemistry (IHC) and related applications.

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

VRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDAQAGGDNSSVQN

Verified Species Reactivity

• Human

Interspecies Information

Highest antigen sequence identity to the following orthologs:

• Rat: ENSRNOG00000045816 (100%)
• Mouse: ENSMUSG00000020524 (100%)

Buffer Composition

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet

Purification Method

Affinity purified using the PrEST antigen as affinity ligand.

사용 시 참고사항

• 사용 전 부드럽게 혼합하십시오.
• 각 응용 분야에 맞는 최적의 농도와 조건은 사용자가 직접 결정해야 합니다.

참고 자료

Open Datasheet

제품 이미지