
Atlas Antibodies Anti-GRHPR Antibody
상품 한눈에 보기
인간 GRHPR 단백질을 인식하는 토끼 폴리클로날 항체입니다. IHC, WB, ICC에 적합하며, PrEST 항원을 이용해 친화 정제되었습니다. 인간에 대한 검증 완료, 쥐 및 생쥐와 높은 서열 유사성을 가집니다. 40% 글리세롤 및 PBS 완충액에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GRHPR Antibody
Target: glyoxylate reductase/hydroxypyruvate reductase (GRHPR)
Host: Rabbit
Clonality: Polyclonal
Isotype: IgG
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against human GRHPR.
Alternative Gene Names
GLXR, PH2
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | glyoxylate reductase/hydroxypyruvate reductase |
| Target Gene | GRHPR |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | GDVVNQDDLYQALASGKIAAAGLDVTSPEPLPTNHPLLTLKNCVILPHIGSATHRTRNTMSLLAANNLLAGLRGEPMPSELKL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000012794 (92%), Mouse ENSMUSG00000035637 (90%) |
Specifications
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2) with 0.02% sodium azide |
| Purification Method | Affinity purified using PrEST antigen |
| Preservative | 0.02% sodium azide (Material Safety Data Sheet) |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GRIA1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRHPR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRHPR Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRHL3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GRHL1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.