
Atlas Antibodies Anti-GREB1L Antibody
상품 한눈에 보기
Human GREB1L 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 특이적 정제되었습니다. Human 반응성이 검증되었으며, 안정적인 PBS/glycerol buffer에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-GREB1L Antibody
growth regulation by estrogen in breast cancer-like
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal Antibody against Human GREB1L
Alternative Gene Names
- C18orf6
- FLJ13687
- KIAA1772
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | growth regulation by estrogen in breast cancer-like |
| Target Gene | GREB1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DEEEINTDHNESSEVSQSEGEPWPDIESFSKMPFDVSVHDPKYSLMSLVYTEKLAGVKQEVIKESKVEEPRKRETVSIMLTKYAAYNT |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Antigen Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000023492 | 86% |
| Mouse | ENSMUSG00000042942 | 84% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-GRHL2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GREB1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GREB1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GREB1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-GREB1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.