AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GREB1L Antibody
상품 한눈에 보기
Human GREB1L 단백질을 인식하는 폴리클로날 항체로, Rabbit에서 생산된 IgG 형식입니다. IHC 등 다양한 응용에 적합하며, PrEST 항원으로 특이적 정제되었습니다. Human 반응성이 검증되었으며, 안정적인 PBS/glycerol buffer에 보존됩니다.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA041647-100 Anti-GREB1L Antibody, growth regulation by estrogen in breast cancer-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA041647-25 Anti-GREB1L Antibody, growth regulation by estrogen in breast cancer-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GREB1L Antibody
Anti-GREB1L Antibody
growth regulation by estrogen in breast cancer-like
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal Antibody against Human GREB1L
Alternative Gene Names
- C18orf6
- FLJ13687
- KIAA1772
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | growth regulation by estrogen in breast cancer-like |
| Target Gene | GREB1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | DEEEINTDHNESSEVSQSEGEPWPDIESFSKMPFDVSVHDPKYSLMSLVYTEKLAGVKQEVIKESKVEEPRKRETVSIMLTKYAAYNT |
Verified Species Reactivity
- Human
Interspecies Information
| 종 | Ortholog ID | Antigen Sequence Identity |
|---|---|---|
| Rat | ENSRNOG00000023492 | 86% |
| Mouse | ENSMUSG00000042942 | 84% |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
Buffer Composition
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Purification Method
Affinity purified using the PrEST antigen as affinity ligand.
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.