AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-GREB1L Antibody
상품 한눈에 보기
Human GREB1L 단백질을 인식하는 토끼 폴리클로날 항체. IHC 등 다양한 응용에 적합. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간에 대한 검증된 반응성과 마우스, 랫트와의 교차 반응 정보 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA044218-100 Anti-GREB1L Antibody, growth regulation by estrogen in breast cancer-like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA044218-25 Anti-GREB1L Antibody, growth regulation by estrogen in breast cancer-like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-GREB1L Antibody
Anti-GREB1L Antibody
Target: Growth regulation by estrogen in breast cancer-like (GREB1L)
Supplier: Atlas Antibodies
Recommended Applications
- Immunohistochemistry (IHC)
Product Description
Polyclonal antibody against human GREB1L protein.
Alternative Gene Names
- C18orf6
- FLJ13687
- KIAA1772
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Growth regulation by estrogen in breast cancer-like |
| Target Gene | GREB1L |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | DEEEINTDHNESSEVSQSEGEPWPDIESFSKMPFDVSVHDPKYSLMSLVYTEKLAGVKQEVIKESKVEEPRKRETVSIMLTKYAAYNT |
Species Reactivity
| 항목 | 내용 |
|---|---|
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000023492 (86%), Mouse ENSMUSG00000042942 (84%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer Composition
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide (preservative)
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기
문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.