
Atlas Antibodies Anti-WRAP53 Antibody
상품 한눈에 보기
인간 WRAP53 단백질을 표적으로 하는 폴리클로날 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. 독립 항체 검증 및 재조합 발현 검증을 거쳤으며, 토끼 유래 IgG 형식으로 높은 특이성과 신뢰성을 제공합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-WRAP53 Antibody
WD repeat containing, antisense to TP53
Recommended Applications
IHC (Independent Antibody Validation)
Validation of protein expression in IHC by comparing independent antibodies targeting different epitopes of the protein.WB (Recombinant Expression Validation)
Recombinant expression validation in WB using target protein overexpression.ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human WRAP53
Alternative Gene Names
FLJ10385, TCAB1, WDR79
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | WD repeat containing, antisense to TP53 |
| Target Gene | WRAP53 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000010520 (81%), Mouse ENSMUSG00000041346 (80%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
| Notes | Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user. |
| MSDS | Material Safety Data Sheet |
Antigen Sequence
GSLSEEEANGPELGSGKAMEDTSGEPAAEDEGDTAWNYSFSQLPRFLSGSWSEFSTQPENFLKGCKWAPDGSCILTNSADNILRIYNLPPELYHEGEQVEYAEMVPVLRMVEGDTIYDYC제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-WRB Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WRAP73 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WRAP53 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WRAP53 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WNT6 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.