CacheBy
Atlas Antibodies Anti-WRAP73 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WRAP73 Antibody

상품 한눈에 보기

Human WRAP73 단백질을 인식하는 rabbit polyclonal antibody. IHC 및 ICC 응용에 적합하며, PrEST 항원을 이용해 친화정제됨. 40% glycerol 기반 PBS buffer에 보존제로 sodium azide 포함. Human에 대한 반응성이 검증됨.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA026893-100 Anti-WRAP73 Antibody, WD repeat containing, antisense to TP73 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA026893-25 Anti-WRAP73 Antibody, WD repeat containing, antisense to TP73 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WRAP73 Antibody

Anti-WRAP73 Antibody

Target: WD repeat containing, antisense to TP73
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human WRAP73 protein.


Alternative Gene Names

  • WDR8

Target Information

항목 내용
Target Protein WD repeat containing, antisense to TP73
Target Gene WRAP73
Verified Species Reactivity Human
Interspecies Identity Mouse (83%), Rat (53%)

Antigen Sequence

Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:

SVPVSLQTLKPVTDRANPKIGIGMLAFSPDSYFLATRNDNIPNAVWVWDIQKLRLFAVLEQLSPVRAFQWDPQQPRLAICTGGSRLYLWSPAGCMSVQVPGEGDFAVLSLCWHLSGDSM

Antibody Specifications

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand
Buffer 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative
MSDS Material Safety Data Sheet

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용에 대한 최적의 농도와 조건은 사용자가 결정해야 합니다.

Reference

Open Datasheet (PDF)


제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.