
Atlas Antibodies Anti-WISP3 Antibody
상품 한눈에 보기
인간 WISP3 단백질을 인식하는 Rabbit Polyclonal 항체로, WNT1 유도 신호 경로 단백질 연구에 적합. CCN6 유전자 타겟. PrEST 항원을 이용한 친화 정제 방식으로 높은 특이성과 재현성 제공. 인간, 마우스, 랫트 교차 반응성 확인.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-WISP3 Antibody
Target: WNT1 inducible signaling pathway protein 3 (WISP3)
Supplier: Atlas Antibodies
Product Description
Polyclonal antibody against human WISP3 (CCN6).
Produced in rabbit and affinity purified using the PrEST antigen as affinity ligand.
Recommended Applications
- Immunocytochemistry (ICC)
Alternative Gene Names
- CCN6
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | WNT1 inducible signaling pathway protein 3 |
| Target Gene | WISP3 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | CQPTFQLSKAEKFVFSGCSSTQSYKPTFCGICLDKRCCIPNKSKMITIQFDCPNEGSFKWKMLWIT |
| Verified Species Reactivity | Human |
| Interspecies Identity | Mouse (88%), Rat (83%) |
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide preservative |
| Purification Method | Affinity purified using the PrEST antigen |
| MSDS | Material Safety Data Sheet |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
Datasheet
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-WIPI2 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WISP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WISP3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WIPF3 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WFIKKN1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.