CacheBy
Atlas Antibodies Anti-WIPI2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WIPI2 Antibody

상품 한눈에 보기

Human WIPI2 단백질을 인식하는 토끼 폴리클로날 항체로, IHC, WB, ICC 분석에 적합합니다. ATG18B 등 다양한 유전자명으로 알려진 WIPI2를 타겟하며, 친화 정제된 고품질 항체입니다. Human, Mouse, Rat 종에 반응성이 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA021488-100 Anti-WIPI2 Antibody, WD repeat domain, phosphoinositide interacting 2 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA021488-25 Anti-WIPI2 Antibody, WD repeat domain, phosphoinositide interacting 2 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WIPI2 Antibody

Anti-WIPI2 Antibody

Target: WD repeat domain, phosphoinositide interacting 2 (WIPI2)


  • Immunohistochemistry (IHC)
  • Western Blot (WB)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against human WIPI2 protein.


Alternative Gene Names

ATG18B, Atg21, CGI-50, DKFZP434J154, DKFZp686P02188, FLJ12979, FLJ14217, FLJ42984

Open Datasheet


Target Information

항목 내용
Target Protein WD repeat domain, phosphoinositide interacting 2
Target Gene WIPI2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence:
ECALMKQHRLDGSLETTNEILDSASHDCPLVTQTYGAAAGKGTYVPSSPTRLAYTDDLGAVGGACLEDEASALRLDEDSEHPPMILRTD

Verified Species Reactivity

Human, Mouse, Rat

Interspecies Information

종 Ortholog ID 항원 서열 유사도
Rat ENSRNOG00000001114 84%
Mouse ENSMUSG00000029578 83%

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지



Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.