CacheBy
Atlas Antibodies Anti-WBP2NL Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WBP2NL Antibody

상품 한눈에 보기

Human WBP2NL 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증을 통해 단백질 발현을 확인함. Affinity purification으로 높은 특이성과 재현성을 제공하며, 다양한 조직 연구에 적합함.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA048557-100 Anti-WBP2NL Antibody, WBP2 N-terminal like 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA048557-25 Anti-WBP2NL Antibody, WBP2 N-terminal like 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WBP2NL Antibody

Anti-WBP2NL Antibody

WBP2 N-terminal like

Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.

Product Description

Polyclonal Antibody against Human WBP2NL

Alternative Gene Names

FLJ26145, MGC26816, PAWP

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein WBP2 N-terminal like
Target Gene WBP2NL
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence QSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGDAIEFAQLMVKAA
Verified Species Reactivity Human
Interspecies Information Rat ENSRNOG00000008038 (72%), Mouse ENSMUSG00000022455 (71%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)

Notes

Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Enhanced Validation
IHC Orthogonal Validation
Orthogonal Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.