
Atlas Antibodies Anti-WBP2NL Antibody
Human WBP2NL 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC Orthogonal 검증을 통해 단백질 발현을 확인함. Affinity purification으로 높은 특이성과 재현성을 제공하며, 다양한 조직 연구에 적합함.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-WBP2NL Antibody
WBP2 N-terminal like
Recommended Applications
Orthogonal validation of protein expression using IHC by comparison to RNA-seq data of corresponding target in high and low expression tissues.
Product Description
Polyclonal Antibody against Human WBP2NL
Alternative Gene Names
FLJ26145, MGC26816, PAWP
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | WBP2 N-terminal like |
| Target Gene | WBP2NL |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | QSHTENRRGALIPNGESLLKRSPNVELSFPQRSEGSNVFSGRKTGTLFLTSYRVIFITSCSISDPMLSFMMPFDLMTNLTVEQPVFAANFIKGTIQAAPYGGWEGQATFKLVFRNGDAIEFAQLMVKAA |
| Verified Species Reactivity | Human |
| Interspecies Information | Rat ENSRNOG00000008038 (72%), Mouse ENSMUSG00000022455 (71%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet (MSDS)
Notes
Gently mix before use. Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-WBSCR17 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WBP4 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WBP2NL Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WBP1L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-WBP2 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|