CacheBy
Atlas Antibodies Anti-WBSCR17 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WBSCR17 Antibody

상품 한눈에 보기

Human WBSCR17 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 WB에 적합. GalNAc-T5L/GALNTL3 대체 유전자명으로 알려짐. 고순도 Affinity purification 방식으로 제조되어 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA013624-100 Anti-WBSCR17 Antibody, Williams-Beuren syndrome chromosome region 17 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA013624-25 Anti-WBSCR17 Antibody, Williams-Beuren syndrome chromosome region 17 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WBSCR17 Antibody

Anti-WBSCR17 Antibody

Target: Williams-Beuren syndrome chromosome region 17 (WBSCR17)
Supplier: Atlas Antibodies


  • Immunohistochemistry (IHC)
  • Western Blot (WB)

Product Description

Polyclonal antibody against human WBSCR17 protein.

Alternative Gene Names: GalNAc-T5L, GALNTL3
Open Datasheet (PDF)


Target Information

항목 내용
Target Protein Williams-Beuren syndrome chromosome region 17
Target Gene WBSCR17
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence RPIAVRSGDAFHEIRPRAEVANLSAHSASPIQDAVLKRLSLLEDIVYRQLNGLSKSLGLIEGYGGRGKGGLPATLSPAEEEKAKGPHEKYGYNSYLSE

Verified Species Reactivity

  • Human
  • Mouse
  • Rat

Interspecies Information:
Highest antigen sequence identity to orthologs:

  • Rat ENSRNOG00000024435 (99%)
  • Mouse ENSMUSG00000034040 (99%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Composition

구성 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

IHC Application
WB Application

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.