CacheBy
Atlas Antibodies Anti-WARS2 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-WARS2 Antibody

상품 한눈에 보기

인간 WARS2 단백질을 인식하는 토끼 유래 폴리클로날 항체. 미토콘드리아 트립토판 tRNA 합성효소2 검출용. ICC 등 다양한 응용에 적합. PrEST 항원으로 친화 정제되어 높은 특이성과 재현성 제공.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA028007-100 Anti-WARS2 Antibody, tryptophanyl tRNA synthetase 2, mitochondrial 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA028007-25 Anti-WARS2 Antibody, tryptophanyl tRNA synthetase 2, mitochondrial 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-WARS2 Antibody

Anti-WARS2 Antibody

Target: tryptophanyl tRNA synthetase 2, mitochondrial (WARS2)
Type: Polyclonal Antibody against Human WARS2
Host: Rabbit


  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody raised in rabbit against human tryptophanyl tRNA synthetase 2, mitochondrial (WARS2).


Alternative Gene Names

  • TrpRS

Target Information

항목 내용
Target Protein tryptophanyl tRNA synthetase 2, mitochondrial
Target Gene WARS2
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VSNIVAVHAAVTGLSVEEVVRRSAGMNTARYKLAVADAVIEKFAPIKREIEKLKLDKDHLEKVLQIGSAKAKELAYTVCQEVKKLVG
Verified Species Reactivity Human
Interspecies Identity Mouse ENSMUSG00000004233 (80%), Rat ENSRNOG00000019508 (80%)

Antibody Characteristics

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer Information

구성 성분 내용
Buffer 40% glycerol and PBS (pH 7.2)
Preservative 0.02% sodium azide
MSDS Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Recommended Applications - ICC

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.