CacheBy
Atlas Antibodies Anti-VTCN1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VTCN1 Antibody

상품 한눈에 보기

Human VTCN1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. B7-H4/B7X 등 다양한 대체 유전자명을 가지며, PrEST 항원으로 정제되었습니다. Human에 대한 반응성이 검증되었으며, 40% glycerol buffer에 보존됩니다.

카탈로그번호
HPA054200-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA054200-100 Anti-VTCN1 Antibody, V-set domain containing T cell activation inhibitor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054200-25 Anti-VTCN1 Antibody, V-set domain containing T cell activation inhibitor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VTCN1 Antibody

Anti-VTCN1 Antibody

V-set domain containing T cell activation inhibitor 1 (VTCN1)

  • Immunohistochemistry (IHC)
  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human VTCN1.

Alternative Gene Names

B7-H4, B7H4, B7S1, B7X, FLJ22418

Open Datasheet

Target Information

항목 내용
Target Protein V-set domain containing T cell activation inhibitor 1
Target Gene VTCN1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence ISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL

Verified Species Reactivity

  • Human

Interspecies Information

Highest antigen sequence identity to orthologs:

  • Mouse ENSMUSG00000051076 (85%)
  • Rat ENSRNOG00000015279 (85%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지


Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.