
Atlas Antibodies Anti-VTCN1 Antibody
상품 한눈에 보기
Human VTCN1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. B7-H4/B7X 등 다양한 대체 유전자명을 가지며, PrEST 항원으로 정제되었습니다. Human에 대한 반응성이 검증되었으며, 40% glycerol buffer에 보존됩니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-VTCN1 Antibody
V-set domain containing T cell activation inhibitor 1 (VTCN1)
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human VTCN1.
Alternative Gene Names
B7-H4, B7H4, B7S1, B7X, FLJ22418
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | V-set domain containing T cell activation inhibitor 1 |
| Target Gene | VTCN1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Mouse ENSMUSG00000051076 (85%)
- Rat ENSRNOG00000015279 (85%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-VTI1B Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VTI1A Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VTCN1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VSTM2L Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-VTA1 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.