
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-VTCN1 Antibody
상품 한눈에 보기
Human VTCN1 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC 및 ICC에 적합합니다. B7-H4/B7X 등 다양한 대체 유전자명을 가지며, PrEST 항원으로 정제되었습니다. Human에 대한 반응성이 검증되었으며, 40% glycerol buffer에 보존됩니다.
- 카탈로그번호
- HPA054200-xxx (2개 옵션)
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
Atlas Antibodies HPA054200-100 Anti-VTCN1 Antibody, V-set domain containing T cell activation inhibitor 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA054200-25 Anti-VTCN1 Antibody, V-set domain containing T cell activation inhibitor 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-VTCN1 Antibody
Anti-VTCN1 Antibody
V-set domain containing T cell activation inhibitor 1 (VTCN1)
Recommended Applications
- Immunohistochemistry (IHC)
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human VTCN1.
Alternative Gene Names
B7-H4, B7H4, B7S1, B7X, FLJ22418
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | V-set domain containing T cell activation inhibitor 1 |
| Target Gene | VTCN1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | ISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRL |
Verified Species Reactivity
- Human
Interspecies Information
Highest antigen sequence identity to orthologs:
- Mouse ENSMUSG00000051076 (85%)
- Rat ENSRNOG00000015279 (85%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
- 40% glycerol and PBS (pH 7.2)
- 0.02% sodium azide preservative
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



