CacheBy
Atlas Antibodies Anti-VTA1 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VTA1 Antibody

상품 한눈에 보기

Human VTA1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human, Mouse, Rat에 반응합니다. 단백질 발현 검증을 위해 독립 항체 비교로 검증되었습니다.

판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
ADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기
Atlas Antibodies HPA030968-100 Anti-VTA1 Antibody, vesicle (multivesicular body) trafficking 1 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA030968-25 Anti-VTA1 Antibody, vesicle (multivesicular body) trafficking 1 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VTA1 Antibody

Anti-VTA1 Antibody

Target: vesicle (multivesicular body) trafficking 1 (VTA1)


  • Immunohistochemistry (IHC)
  • Western Blot (WB, independently validated)

Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.


Product Description

Polyclonal antibody against Human VTA1.


Alternative Gene Names

C6orf55, HSPC228, My012

Open Datasheet (PDF)


Target Information

항목 내용
Target Protein vesicle (multivesicular body) trafficking 1
Target Gene VTA1
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence FKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA

Species Reactivity

종 반응성
Human Verified
Mouse Verified
Rat Verified

Interspecies Information:
Highest antigen sequence identity to the following orthologs:

  • Mouse ENSMUSG00000019868 (100%)
  • Rat ENSRNOG00000011540 (100%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet


Notes

Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.


제품 이미지

Enhanced Validation
IHC Application
WB Validation
Independent Validation Tooltip

Atlas Antibodies 상품 둘러보기

전체보기

문의

0개

아직 등록된 문의가 없어요.