Atlas Antibodies Anti-VTA1 Antibody
Human VTA1 단백질을 인식하는 Rabbit Polyclonal 항체로, WB 및 IHC에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Human, Mouse, Rat에 반응합니다. 단백질 발현 검증을 위해 독립 항체 비교로 검증되었습니다.
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-VTA1 Antibody
Target: vesicle (multivesicular body) trafficking 1 (VTA1)
Recommended Applications
- Immunohistochemistry (IHC)
- Western Blot (WB, independently validated)
Validation:
Validation of protein expression in WB by comparing independent antibodies targeting different epitopes of the protein.
Product Description
Polyclonal antibody against Human VTA1.
Alternative Gene Names
C6orf55, HSPC228, My012
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | vesicle (multivesicular body) trafficking 1 |
| Target Gene | VTA1 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | FKSIQHHLRTAQEHDKRDPVVAYYCRLYAMQTGMKIDSKTPECRKFLSKLMDQLEALKKQLGDNEA |
Species Reactivity
| 종 | 반응성 |
|---|---|
| Human | Verified |
| Mouse | Verified |
| Rat | Verified |
Interspecies Information:
Highest antigen sequence identity to the following orthologs:
- Mouse ENSMUSG00000019868 (100%)
- Rat ENSRNOG00000011540 (100%)
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide is added as preservative.
Material Safety Data Sheet
Notes
Gently mix before use.
Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|