CacheBy
Atlas Antibodies Anti-VPS8 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS8 Antibody

상품 한눈에 보기

Human VPS8 단백질을 인식하는 Rabbit Polyclonal Antibody. IHC 등 다양한 응용에 적합. PrEST 항원으로 특이적 친화 정제. 인간에 대한 반응성 검증 완료. 안정적인 PBS/glycerol buffer에 보존.

카탈로그번호
HPA036871-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA036871-100 Anti-VPS8 Antibody, vacuolar protein sorting 8 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA036871-25 Anti-VPS8 Antibody, vacuolar protein sorting 8 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS8 Antibody

Anti-VPS8 Antibody

Target: Vacuolar protein sorting 8 homolog (S. cerevisiae)

면역조직화학 (IHC)

Product Description

Polyclonal antibody against Human VPS8.

Alternative Gene Names

FLJ32099, KIAA0804

Open Datasheet

Target Information

  • Target Protein: Vacuolar protein sorting 8 homolog (S. cerevisiae)
  • Target Gene: VPS8
  • Antigen Sequence: Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
EEIYPYIRTLLHFDTREFLNVLALTFEDFKNDKQAVEYQQRIVDILLKVMVENSDFTPSQVGCLFTFLARQLA

Verified Species Reactivity

Human

Interspecies Information

Species Gene ID Sequence Identity
Rat ENSRNOG00000001764 97%
Mouse ENSMUSG00000033653 97%

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Buffer 40% glycerol and PBS (pH 7.2). 0.02% sodium azide added as preservative. (Material Safety Data Sheet)
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Notes

  • 사용 전 부드럽게 혼합하십시오.
  • 각 응용 분야에 맞는 최적 농도와 조건은 사용자가 직접 결정해야 합니다.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.