CacheBy
Atlas Antibodies Anti-VPS54 Antibody
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2

Atlas Antibodies Anti-VPS54 Antibody

상품 한눈에 보기

휴먼 VPS54 단백질을 인식하는 폴리클로나 항체로, 토끼에서 생산됨. PrEST 항원을 이용해 친화정제되었으며, 인체 반응성이 검증됨. 세포 내 단백질 분류 연구에 적합. PBS와 글리세롤 기반 버퍼에 보존제 포함.

카탈로그번호
HPA055894-xxx (2개 옵션)
판매단위
100ul, 25ul
카탈로그 보기

카탈로그

2개 옵션
회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
Atlas Antibodies HPA055894-100 Anti-VPS54 Antibody, vacuolar protein sorting 54 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055894-25 Anti-VPS54 Antibody, vacuolar protein sorting 54 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원

Atlas Antibodies · Atlas Antibodies Anti-VPS54 Antibody

Anti-VPS54 Antibody

Target: vacuolar protein sorting 54 homolog (S. cerevisiae)

  • Immunocytochemistry (ICC)

Product Description

Polyclonal antibody against Human VPS54.

Alternative Gene Names

  • HCC8
  • PPP1R164

Open Datasheet (PDF)

Target Information

항목 내용
Target Protein vacuolar protein sorting 54 homolog (S. cerevisiae)
Target Gene VPS54
Antigen Sequence Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Epitope Sequence VDIMVSEDMKLTDSELGKLANNIQELLYSASDICHDRAVKFLMSRAKDGFLEKLNSMEFITLSRLMETFILDTEQICGRKSTSLLGAL
Verified Species Reactivity Human
Interspecies Identity Rat ENSRNOG00000007125 (89%), Mouse ENSMUSG00000020128 (86%)

Antibody Properties

항목 내용
Clonality Polyclonal
Isotype IgG
Host Rabbit
Purification Method Affinity purified using the PrEST antigen as affinity ligand

Buffer

40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet

Notes

  • Gently mix before use.
  • Optimal concentrations and conditions for each application should be determined by the user.

제품 이미지

Atlas Antibodies 상품 둘러보기

전체보기

문의

0

아직 등록된 문의가 없어요.