
AI 생성AI가 생성·보정한 이미지예요. AI는 실수할 수 있으니 실제 제품과 다를 수 있어요.
1 / 2Atlas Antibodies Anti-VPS54 Antibody
상품 한눈에 보기
휴먼 VPS54 단백질을 인식하는 폴리클로나 항체로, 토끼에서 생산됨. PrEST 항원을 이용해 친화정제되었으며, 인체 반응성이 검증됨. 세포 내 단백질 분류 연구에 적합. PBS와 글리세롤 기반 버퍼에 보존제 포함.
- 판매단위
- 100ul, 25ul
카탈로그
2개 옵션 · 카탈로그 번호를 클릭하면 복사됩니다회원가입 없이 바로 구매하세요
가입하지 않아도 비회원가로 구매하실 수 있습니다.
카탈로그 번호 · 상품 설명출고판매가담기
ADADRepligen 웨비나PATsmart를 활용한 바이오공정 분석 전략 · 10/7 오전 10시자세히보기Atlas Antibodies HPA055894-100 Anti-VPS54 Antibody, vacuolar protein sorting 54 homolog (S. cerevisiae) 100ul판매 단위 100ul ·
재고 확인 필요
728,000원VAT 포함 800,800원
Atlas Antibodies HPA055894-25 Anti-VPS54 Antibody, vacuolar protein sorting 54 homolog (S. cerevisiae) 25ul판매 단위 25ul ·
재고 확인 필요
528,000원VAT 포함 580,800원
Atlas Antibodies · Atlas Antibodies Anti-VPS54 Antibody
Anti-VPS54 Antibody
Target: vacuolar protein sorting 54 homolog (S. cerevisiae)
Recommended Applications
- Immunocytochemistry (ICC)
Product Description
Polyclonal antibody against Human VPS54.
Alternative Gene Names
- HCC8
- PPP1R164
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | vacuolar protein sorting 54 homolog (S. cerevisiae) |
| Target Gene | VPS54 |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Epitope Sequence | VDIMVSEDMKLTDSELGKLANNIQELLYSASDICHDRAVKFLMSRAKDGFLEKLNSMEFITLSRLMETFILDTEQICGRKSTSLLGAL |
| Verified Species Reactivity | Human |
| Interspecies Identity | Rat ENSRNOG00000007125 (89%), Mouse ENSMUSG00000020128 (86%) |
Antibody Properties
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Buffer
40% glycerol and PBS (pH 7.2).
0.02% sodium azide added as preservative.
Material Safety Data Sheet
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
Atlas Antibodies 상품 둘러보기
전체보기문의
0개 · 배송·재고 문의는 실시간 상담이 빠릅니다아직 등록된 문의가 없어요.



