
Atlas Antibodies Anti-USH1C Antibody
상품 한눈에 보기
Human USH1C 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Orthogonal validation으로 검증되었습니다. Human 및 Mouse에 반응합니다.
브랜드: Atlas Antibodies
✨AI 추천 연관 상품
AI가 분석한 이 상품과 연관된 추천 상품들을 확인해보세요
연관 상품을 찾고 있습니다...
Anti-USH1C Antibody
Target: Usher syndrome 1C (autosomal recessive, severe)
Supplier: Atlas Antibodies
Recommended Applications
- IHC (Immunohistochemistry)
- WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines
- ICC (Immunocytochemistry)
Product Description
Polyclonal Antibody against Human USH1C
Alternative Gene Names
AIE-75, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-73, PDZ73, PDZD7C
Target Information
| 항목 | 내용 |
|---|---|
| Target Protein | Usher syndrome 1C (autosomal recessive, severe) |
| Target Gene | USH1C |
| Antigen Sequence | Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence |
| Sequence | IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM |
| Verified Species Reactivity | Human, Mouse |
| Interspecies Information | Mouse ENSMUSG00000030838 (86%), Rat ENSRNOG00000021149 (85%) |
Antibody Characteristics
| 항목 | 내용 |
|---|---|
| Clonality | Polyclonal |
| Isotype | IgG |
| Host | Rabbit |
| Buffer | 40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet |
| Purification Method | Affinity purified using the PrEST antigen as affinity ligand |
Notes
- Gently mix before use.
- Optimal concentrations and conditions for each application should be determined by the user.
제품 이미지
🏷️Atlas Antibodies 상품 둘러보기
동일 브랜드의 다른 상품들을 확인해보세요

Atlas Antibodies
Atlas Antibodies Anti-USMG5 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-USHBP1 Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-USH1C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-USH1C Antibody
528,000원

Atlas Antibodies
Atlas Antibodies Anti-USF3 Antibody
528,000원
배송/결제/교환/반품 안내
배송 정보
| 기본 배송비 |
| 교환/반품 배송비 |
|
|---|---|---|---|
| 착불 배송비 |
| ||
| 교환/반품 배송비 |
| ||
결제 및 환불 안내
| 결제수단 |
|
|---|---|
| 취소 |
|
| 반품 |
|
| 환급 |
|
교환 및 반품 접수
| 교환 및 반품 접수 기한 |
|
|---|---|
| 교환 및 반품 접수가 가능한 경우 |
|
| 교환 및 반품 접수가 불가능한 경우 |
|
교환 및 반품 신청
| 교환 절차 |
|
|---|---|
| 반품 절차 |
|
문의 0
로그인 후 문의를 할 수 있습니다.