Atlas Antibodies Anti-USH1C Antibody

상품 한눈에 보기

Human USH1C 단백질을 인식하는 Rabbit Polyclonal 항체로, IHC, WB, ICC 등 다양한 응용에 적합합니다. PrEST 항원을 이용해 친화 정제되었으며, Orthogonal validation으로 검증되었습니다. Human 및 Mouse에 반응합니다.

브랜드: Atlas Antibodies
카테고리: Polyclonal Antibodies
판매단위: 100ul, 25ul

#Antibodies #Atlas Antibodies

카탈로그

2개 옵션

회원가입 없이 바로 구매하세요

가입하지 않아도 비회원가로 구매하실 수 있습니다.

카탈로그 번호 · 상품 설명출고판매가담기

Atlas Antibodies HPA027398-100 Anti-USH1C Antibody, Usher syndrome 1C (autosomal recessive, severe) 100ul판매 단위 100ul ·

재고 확인 필요재고 확인 필요

728,000원VAT 포함 800,800원

Atlas Antibodies HPA027398-25 Anti-USH1C Antibody, Usher syndrome 1C (autosomal recessive, severe) 25ul판매 단위 25ul ·

재고 확인 필요재고 확인 필요

528,000원VAT 포함 580,800원

재고문의·견적요청 옵션은 실시간 상담으로 납기를 확인해 드립니다 · 연구비 카드 결제 가능

Atlas Antibodies · Atlas Antibodies Anti-USH1C Antibody

Anti-USH1C Antibody

Target: Usher syndrome 1C (autosomal recessive, severe)
Supplier: Atlas Antibodies

Recommended Applications

IHC (Immunohistochemistry)
WB (Western Blot) – Orthogonal validation of protein expression using WB by comparison to RNA-seq data of corresponding target in high and low expression cell lines
ICC (Immunocytochemistry)

Product Description

Polyclonal Antibody against Human USH1C

Alternative Gene Names

AIE-75, DFNB18, harmonin, NY-CO-37, NY-CO-38, PDZ-73, PDZ73, PDZD7C

Open Datasheet

Target Information

항목	내용
Target Protein	Usher syndrome 1C (autosomal recessive, severe)
Target Gene	USH1C
Antigen Sequence	Recombinant Protein Epitope Signature Tag (PrEST) antigen sequence
Sequence	IVEEEEKFKKQWEEDWGSKEQLLLPKTITAEVHPVPLRKPKYDQGVEPELEPADDLDGGTEEQGEQDFRKYEEGFDPYSM
Verified Species Reactivity	Human, Mouse
Interspecies Information	Mouse ENSMUSG00000030838 (86%), Rat ENSRNOG00000021149 (85%)

Antibody Characteristics

항목	내용
Clonality	Polyclonal
Isotype	IgG
Host	Rabbit
Buffer	40% glycerol and PBS (pH 7.2), 0.02% sodium azide added as preservative. Material Safety Data Sheet
Purification Method	Affinity purified using the PrEST antigen as affinity ligand